Recombinant Macaca fascicularis DnaJ homolog subfamily C member 18 (DNAJC18)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant DNAJC18 is produced in Escherichia coli with an N-terminal His-tag for affinity purification. The workflow includes:

  • Expression: Full-length protein (1–358 aa) is expressed in E. coli under optimized conditions.

  • Purification: Chromatography-based methods (e.g., Ni-NTA affinity) yield >90% purity .

  • Reconstitution: Lyophilized powder is dissolved in deionized sterile water (0.1–1.0 mg/mL) with optional glycerol (5–50%) for long-term stability at -20°C/-80°C .

Critical Handling Notes:

  • Avoid repeated freeze-thaw cycles.

  • Store working aliquots at 4°C for ≤1 week.

Related Recombinant DNAJC18 Products

Variants of DNAJC18 are available across species and tags for comparative studies:

SpeciesTagProtein LengthHostPuritySource
Macaca fascicularisHisFull-lengthE. coli>90%
HumanGSTFull-lengthE. coli≥85%
BovineHisFull-lengthE. coli≥85%
ChickenGSTPartialMammalian≥85%

Note: GST-tagged versions enable alternative purification strategies but may affect binding kinetics .

References

  1. Creative Biomart. Recombinant Full Length Macaca fascicularis DnaJ homolog subfamily C member 18 (DNAJC18) Protein, His-Tagged.

  2. MyBioSource. Recombinant Macaca fascicularis DnaJ homolog subfamily C member 18 (DNAJC18).

  3. NCBI PMC. Genome-based analysis of the nonhuman primate Macaca fascicularis.

  4. ScienceDirect. Comparative genomics reveals the hybrid origin of a macaque group.

  5. BioRxiv. Advancing pre-clinical species genetic utility through a high-quality Macaca fascicularis genome.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your own preparations.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Should you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
DNAJC18; QflA-15848; DnaJ homolog subfamily C member 18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
DNAJC18
Target Protein Sequence
MAATLGSGERWTEAYIDAVRRNKYPEDTPPESHDPCGCCNCVKAQKEKKSENEWTQTRQG EGSSMYSEEQLLGVQRIKKCRNYYEILGVSRDASDEELKKAYRKLALKFHPDKNCAPGAT DAFKAIGNAFAVLSNPDKRLRYDEYGDEQVTFTAPRARPYNYYRDFEADITPEELSNVFF GGHFPTGNIHMFSNVTDDAHYYRRRHRHERTQTQKEEEEEKPQTTYSAFIQLLPVLVIVI ISVITQLLATNPPYSLFYKSTLGYTISRETQNLQVPYFVDKNFDKAYRGASLHDLEKTIE KDYIDYIRTSCWKEKQQKSELTNLAGLYRDERLKQKAESLKLENCEKLSKLIGLRRGG
Uniprot No.

Target Background

Database Links

UniGene: Mfa.697

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is DNAJC18 and what is its predicted function in Macaca fascicularis?

DNAJC18 (DnaJ Heat Shock Protein Family Member C18) is a type III member of the DnaJ/Hsp40 protein family. In Macaca fascicularis and other mammals, it is predicted to enable Hsp70 protein binding activity and participate in cellular protein quality control mechanisms. Specifically, DNAJC18 is believed to be involved in cellular responses to misfolded proteins, chaperone cofactor-dependent protein refolding, and the ubiquitin-dependent ERAD (Endoplasmic Reticulum-Associated Degradation) pathway . Structurally, it is predicted to be an integral component of cellular membranes with particular activity in the endoplasmic reticulum membrane .

What is the tissue expression pattern of DNAJC18 in primates?

Based on studies in related mammalian models, DNAJC18 shows a highly tissue-specific expression pattern. Research in rat models has demonstrated that DNAJC18 is predominantly expressed in testicular tissue, with expression beginning during postnatal development (around week 4) and continuing into adulthood . Within testicular tissue, DNAJC18 mRNA has been detected in developing germ cells, specifically during the maturation stages of late pachytene, round spermatids, and elongated spermatids . Though primate-specific expression patterns may differ slightly from rodent models, the strong testicular specificity suggests a conserved role in reproductive system development across mammalian species.

How do recombinant DNAJC18 proteins differ between macaque subspecies?

There are significant genetic variations between macaque subspecies that can affect the structure and function of proteins including DNAJC18. At least six rhesus macaque subspecies have been documented, displaying a variety of morphological, physiological, and behavioral characteristics . These differences may impact protein structure, post-translational modifications, and functional activity of DNAJC18. Geographical variations among macaque populations in locations including Sumatra, Mauritius, Singapore, Cambodia, and the Philippines further contribute to genetic diversity that can affect recombinant protein production and experimental outcomes . Researchers should carefully document and consider the specific macaque subspecies origin when working with recombinant DNAJC18.

What expression vectors are suitable for producing recombinant Macaca fascicularis DNAJC18?

For mammalian expression of DNAJC18, mammalian expression vectors such as pEGFP-C1 have been successfully used for creating fusion proteins for localization and functional studies . For bacterial expression systems, vectors containing strong promoters like T7 may be suitable, especially when coupled with appropriate affinity tags for purification. When designing expression constructs, researchers should consider including the complete 357 amino acid open reading frame of DNAJC18 to ensure proper folding and function . The inclusion of species-specific codon optimization may improve expression efficiency, particularly when expressing macaque proteins in non-primate expression systems.

How does the structure-function relationship of DNAJC18 differ between humans and Macaca fascicularis?

The structure-function relationship of DNAJC18 between humans and Macaca fascicularis requires detailed comparative analysis due to potentially significant interspecies variations. While the core DnaJ domain is likely conserved due to its essential function in Hsp70 interaction, differences in regulatory domains and post-translational modification sites may exist. Human and macaque MHC gene structure shows substantial differences, with macaques having greater copy numbers of immune-related genes than humans . This pattern of genomic variation suggests that even for highly conserved proteins like DNAJC18, subtle but functionally significant differences may exist between species. Researchers should perform detailed sequence alignments and structural predictions when extrapolating between human and macaque DNAJC18 functions.

What are the methodological challenges in studying DNAJC18 subcellular localization in Macaca fascicularis cells?

Studying the subcellular localization of DNAJC18 in Macaca fascicularis cells presents several methodological challenges. Previous studies with rat DNAJC18 used GFP-tagged fusion proteins and confocal microscopy to determine cytoplasmic localization . For macaque DNAJC18, researchers should consider:

  • Cell type selection: Primary macaque cells versus established cell lines

  • Transfection efficiency: Optimizing protocols specifically for macaque cells

  • Tag interference: Ensuring GFP or other tags don't disrupt protein localization

  • Antibody specificity: Developing antibodies that specifically recognize macaque DNAJC18

  • Co-localization markers: Using appropriate organelle markers to precisely identify subcellular compartments

Based on findings in other mammalian systems, DNAJC18 is predicted to be associated with the endoplasmic reticulum membrane , but species-specific variations in localization patterns may exist and should be empirically determined.

How can researchers effectively model DNAJC18 function in the context of protein quality control pathways?

Modeling DNAJC18 function in protein quality control pathways requires a multi-faceted experimental approach. Based on its predicted involvement in cellular responses to misfolded proteins and the ERAD pathway , researchers can:

  • Develop in vitro assays measuring DNAJC18 interactions with Hsp70 chaperones

  • Create cell stress models using heat shock, chemical stressors, or expression of known misfolded proteins

  • Employ CRISPR/Cas9 gene editing to create DNAJC18 knockout or modified cell lines

  • Utilize proximity labeling techniques (BioID, APEX) to identify DNAJC18 interacting partners

  • Develop functional assays measuring protein degradation rates in the presence and absence of DNAJC18

For Macaca fascicularis-specific studies, researchers should consider developing species-appropriate cell models, potentially including induced pluripotent stem cells (iPSCs) derived from macaque tissues to ensure physiologically relevant contexts.

What are the implications of DNAJC18 tissue specificity for translational research using macaque models?

The apparent tissue specificity of DNAJC18, particularly its expression in testicular tissue , has significant implications for translational research using macaque models. This specificity suggests:

  • DNAJC18 may play specialized roles in reproductive biology and fertility

  • Studies involving DNAJC18 modulation may have particular relevance to reproductive toxicology

  • Sex-specific differences may exist in experimental outcomes related to DNAJC18 function

  • Developmental timing of experiments may be critical given the postnatal onset of expression

  • Tissue-specific regulatory mechanisms may govern DNAJC18 expression in different contexts

Researchers using macaque models should carefully consider these factors when designing experiments, particularly when extrapolating findings to human health applications or when considering potential off-target effects of interventions targeting DNAJC18 or related pathways.

What are the optimal conditions for expressing and purifying recombinant Macaca fascicularis DNAJC18?

Based on the characteristics of DNAJC18 and general recombinant protein purification principles, the following conditions are recommended:

Expression System Selection:

  • Mammalian expression systems (e.g., HEK293, CHO cells) for fully post-translationally modified protein

  • Bacterial systems (E. coli) for higher yield but potentially altered folding

  • Insect cell systems (Sf9, Hi5) as a compromise between yield and modification

Purification Strategy:

  • Use affinity tags (His6, GST, or FLAG) positioned to minimize interference with function

  • Include protease inhibitors during extraction to prevent degradation

  • Consider membrane protein extraction protocols if membrane association is confirmed

  • Use size exclusion chromatography as a polishing step to ensure homogeneity

  • Validate protein identity using mass spectrometry and Western blotting

Quality Control:

  • Assess purity by SDS-PAGE (expected MW approximately 41.2 kDa based on rat ortholog)

  • Confirm identity by mass spectrometry

  • Verify activity through functional assays measuring Hsp70 interaction

How can researchers effectively generate and validate antibodies against Macaca fascicularis DNAJC18?

Generating specific antibodies against Macaca fascicularis DNAJC18 requires careful epitope selection and validation:

Epitope Selection Strategy:

  • Identify unique, surface-exposed regions of DNAJC18 using structural prediction tools

  • Avoid highly conserved regions that may cross-react with other DnaJ family proteins

  • Consider both N and C-terminal peptides for polyclonal antibody generation

  • For monoclonal antibodies, select 2-3 distinct epitopes to increase success probability

Validation Methods:

  • Western blot against recombinant protein and macaque tissue lysates (expect ~41.2 kDa band)

  • Immunoprecipitation followed by mass spectrometry

  • Immunohistochemistry on tissues with known expression patterns (e.g., testis)

  • Competition assays with immunizing peptides

  • Testing on DNAJC18 knockout or knockdown samples as negative controls

Cross-Reactivity Assessment:

  • Test against human and rodent samples to determine cross-species reactivity

  • Evaluate against other DnaJ family members to confirm specificity

  • Consider testing across multiple macaque subspecies if relevant to research goals

What experimental approaches are most effective for studying DNAJC18 function in Macaca fascicularis models?

To effectively study DNAJC18 function in Macaca fascicularis models, researchers can employ multiple complementary approaches:

Cellular Models:

  • Develop primary cell cultures from relevant macaque tissues (particularly testis)

  • Create stable cell lines with inducible DNAJC18 expression or knockdown

  • Use macaque-derived cell lines when available to maintain species-specific context

Functional Assays:

  • Co-immunoprecipitation to identify interaction partners

  • Protein folding and refolding assays to assess chaperone function

  • Protein degradation assays to evaluate ERAD pathway involvement

  • Cell stress response measurements under various challenge conditions

  • Subcellular fractionation to confirm membrane localization and organelle association

Genetic Manipulation:

  • siRNA or shRNA knockdown for transient functional studies

  • CRISPR/Cas9 genome editing for generating knockout or modified cell lines

  • Overexpression studies using wild-type and mutant DNAJC18 constructs

In Vivo Approaches:
For ethically approved non-human primate studies, consider targeted delivery of modulators to specific tissues of interest (particularly reproductive tissues given the expression pattern) .

How do genetic differences between macaque subspecies affect DNAJC18 research translatability?

The genetic diversity among macaque subspecies can significantly impact the translatability of DNAJC18 research results:

Subspecies Variations:
There are at least six recognized rhesus macaque subspecies with diverse morphological, physiological, and behavioral characteristics . These differences extend to the genetic level and can affect protein function and expression patterns.

Geographical Considerations:
Macaque populations from different geographical regions (Sumatra, Mauritius, Singapore, Cambodia, and the Philippines) show genetic variations that can influence experimental outcomes . These variations may affect:

  • Protein sequence and structure

  • Expression regulation and timing

  • Interacting protein partners

  • Response to experimental manipulations

Implications for Research Design:

What considerations are important when extrapolating DNAJC18 findings from macaque models to human applications?

When translating DNAJC18 research from macaque models to human applications, several important factors must be considered:

Genetic Divergence:
Despite the evolutionary proximity of macaques to humans, significant genetic differences exist. For example, macaques have higher copy numbers of MHC and immune-related genes compared to humans and great apes , suggesting that even for conserved proteins like DNAJC18, functional differences may exist.

Tissue-Specific Expression Patterns:
If the tissue-specific expression pattern observed in rat models (predominantly in testis) is conserved in macaques, this has implications for human translation, particularly for reproductive biology applications.

Protein Interaction Networks:
Differences in protein interaction networks between species may affect DNAJC18 function even if the protein itself is highly conserved. Researchers should validate key interaction partners across species.

Translational Considerations Table:

AspectMacaque-Human ConsiderationResearch Implication
Sequence homologyLikely high but requires verificationConfirm sequence identity percentage before extrapolation
Expression patternMay differ in tissue specificity or timingValidate expression in human tissues of interest
Protein interactionsSpecies-specific interaction partners possibleVerify key interactions in human cells
Regulatory mechanismsPromoter and regulatory elements may differConsider species differences in expression regulation
Post-translational modificationsMay vary between speciesCompare modification patterns between species

How can single-cell techniques advance our understanding of DNAJC18 function in Macaca fascicularis tissues?

Single-cell approaches offer powerful new ways to investigate DNAJC18 function in macaque tissues:

Single-Cell RNA Sequencing:
This technique can precisely map DNAJC18 expression across different cell populations within tissues, potentially revealing:

  • Previously undetected expression in rare cell types

  • Dynamic expression changes during developmental processes

  • Co-expression patterns with potential functional partners

  • Cell type-specific splicing variants

For tissues like testis where DNAJC18 has shown specific expression , single-cell approaches could delineate the exact spermatogenic stages and cell types expressing the protein.

Single-Cell Proteomics:
Emerging single-cell proteomics techniques can determine:

  • Cell-specific protein levels and post-translational modifications

  • Protein-protein interaction networks at the single-cell level

  • Subcellular localization patterns across different cell populations

Spatial Transcriptomics and Proteomics:
These approaches maintain spatial information while profiling gene or protein expression, enabling:

  • Precise mapping of DNAJC18 expression within tissue architecture

  • Identification of spatial relationships with other proteins

  • Understanding of expression in relation to tissue microenvironments

What are the promising approaches for studying DNAJC18 in protein quality control pathways in primates?

Several innovative approaches can advance our understanding of DNAJC18's role in protein quality control:

Proximity Labeling Techniques:
Methods like BioID or APEX2 can identify proteins physically close to DNAJC18 in living cells, revealing:

  • Direct interaction partners in the endoplasmic reticulum membrane

  • Transient associations during stress responses

  • Clients undergoing chaperone-assisted folding

Live-Cell Imaging of Protein Dynamics:
Using approaches such as:

  • FRAP (Fluorescence Recovery After Photobleaching) to study DNAJC18 mobility

  • FRET (Förster Resonance Energy Transfer) to detect protein-protein interactions

  • Optogenetic tools to manipulate DNAJC18 activity with spatial and temporal precision

Integrative Multi-Omics:
Combining multiple data types:

  • Transcriptomics to identify co-regulated genes

  • Proteomics to map interaction networks

  • Metabolomics to detect downstream functional consequences

  • Systems biology approaches to integrate these diverse data types

Structural Biology:
Advanced structural techniques can reveal:

  • Cryo-EM structures of DNAJC18 alone or in complexes

  • X-ray crystallography of key domains

  • NMR studies of dynamic interactions with client proteins or Hsp70

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.