Recombinant Macaca fascicularis Elongation of very long chain fatty acids protein 4 (ELOVL4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will accommodate your request as best as possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Standard shipping includes blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing that tag type.
Synonyms
ELOVL4; QtrA-14469; Elongation of very long chain fatty acids protein 4; 3-keto acyl-CoA synthase ELOVL4; ELOVL fatty acid elongase 4; ELOVL FA elongase 4; Very long chain 3-ketoacyl-CoA synthase 4; Very long chain 3-oxoacyl-CoA synthase 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
ELOVL4
Target Protein Sequence
MGLLDSEPGSVLNVVSTALNDTVEFYRWTWSIADKRVENWPLMQSPWPTLSISTLYLLFV WLGPKWMKDREPFQMRLVLIIYNFGMVLLNFFIFRELFMGSYNAGYSYICQSVDYSNNVN EVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYHHCTMFTLWWIGIKWVAGGQ AFFGAQMNSFIHVIMYSYYGLAAFGPWIQKYLWWKRYLTMLQLVQFHVTIGHTALSLYTD CPFPKWMHWALIAYAISFIFLFLNFYIRTYKEPKKPKTGKTAMNGISANGVSKSEKQLVI ENGKKQKNGKAKGD
Uniprot No.

Target Background

Function
This endoplasmic reticulum-bound enzyme catalyzes the first and rate-limiting step in the four-reaction cycle that elongates long-chain fatty acids. This process allows the addition of two carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. This condensing enzyme catalyzes the synthesis of very long chain saturated (VLC-SFA) and polyunsaturated (PUFA) fatty acids. These fatty acids are involved in various biological processes, serving as precursors for membrane lipids and lipid mediators. ELOVL4 may play a crucial role in the early development of the brain and skin.
Database Links

KEGG: mcf:102138130

UniGene: Mfa.1233

Protein Families
ELO family, ELOVL4 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed mainly in retina. Also expressed in skin and thymus.

Q&A

What is Macaca fascicularis ELOVL4 and what is its primary function in cellular physiology?

Macaca fascicularis (cynomolgus monkey) ELOVL4 is an enzyme belonging to the elongation of very long chain fatty acids (ELOVL) family. It functions as an essential enzyme that mediates the initial rate-limiting step of the fatty acyl chain condensation reaction in very long fatty acid elongation. ELOVL4 specifically catalyzes the biosynthesis of both very long chain polyunsaturated fatty acids (VLC-PUFA) and very long chain saturated fatty acids (VLC-SFA) in a tissue-specific manner . These fatty acids are collectively referred to as very long chain fatty acids (VLC-FA). The enzyme plays critical roles in maintaining retina and brain function, neuroprotection, skin permeability barrier maintenance, and sperm function, highlighting its physiological importance across multiple systems .

How does monkey ELOVL4 compare structurally to human and mouse homologues?

Sequence analysis of monkey ELOVL4 reveals a high degree of homology between human and monkey forms. The cloned full-length cDNA of Macaca fascicularis ELOVL4 encodes a protein of 314 amino acids, which is identical in length to the human homologue and two amino acids longer than the mouse version . Structurally, monkey ELOVL4 preserves the characteristic features typical of the super family of ELO enzymes, which are involved in the metabolism of membrane-bound fatty acid elongation . The high conservation of ELOVL4 across species (monkey, human, and mouse) suggests its essential evolutionary role in fatty acid metabolism, particularly in specialized tissues such as the retina .

What is the tissue distribution pattern of ELOVL4 in Macaca fascicularis?

Real-time quantitative PCR studies have demonstrated that Macaca fascicularis ELOVL4 is expressed in a highly tissue-specific manner. While the retina shows significant expression, comparable levels are also observed in the skin (approximately 90% of retinal expression) and thymus (approximately 111% of retinal expression) . Significant expression was also detected in the brain but at substantially lower levels (less than 9% of retinal expression) . Within the retina itself, immunohistochemical analysis has localized ELOVL4 protein predominantly to the photoreceptor layer, specifically in both rod and cone photoreceptors . This distinctive expression pattern provides important clues about the tissue-specific functions of ELOVL4 in primates .

Why is ELOVL4 particularly important in retinal physiology?

ELOVL4 plays a crucial role in retinal physiology through its production of VLC-PUFAs, which are essential components of photoreceptor membranes. In the retina, VLC-PUFAs and their bioactive derivatives termed "Elovanoids" are necessary for normal retinal function . The importance of ELOVL4 in the retina is evidenced by the fact that mutations in the ELOVL4 gene cause Stargardt-like macular dystrophy (STGD3), an autosomal dominant disorder characterized by early-onset loss of central vision and macular degeneration similar to age-related macular degeneration (AMD) . These patients typically show accumulation of lipofuscin in the retinal pigment epithelium (RPE) and progressive macular degeneration . The localization of ELOVL4 protein to both rod and cone photoreceptors in the monkey retina further underscores its importance in maintaining the structural and functional integrity of these light-sensitive cells .

How do mutations in ELOVL4 correlate with different human disorders?

Different mutations in ELOVL4 lead to distinct tissue-specific human disorders, reflecting the diverse roles of ELOVL4-derived lipids in various tissues. Mutations in ELOVL4 can cause:

  • Stargardt-like macular dystrophy (STGD3): Caused by heterozygous mutations that result in early-onset vision loss and macular degeneration .

  • Spinocerebellar ataxia 34 (SCA34): Associated with heterozygous mutations that lead to age-related progressive ataxia, ocular movement disturbances, dysarthria, and pontocerebellar atrophy .

  • Erythrokeratodermia variabilis (EKV): A skin disorder that can occur alone or in combination with SCA34, characterized by erythematous skin lesions .

  • Severe neurodevelopmental disorders: Homozygous mutations cause more severe conditions featuring seizures, intellectual disability, and childhood mortality .

The correlation between specific mutations and clinical presentations demonstrates how different alterations in the same gene can affect VLC-FA biosynthesis in different tissues, leading to varied pathological manifestations .

What expression systems are most effective for producing functional recombinant Macaca fascicularis ELOVL4?

For producing functional recombinant Macaca fascicularis ELOVL4, mammalian expression systems are typically preferred over bacterial systems due to the need for proper post-translational modifications and membrane insertion. Based on published research methodologies, the following approaches are recommended:

  • Human embryonic kidney (HEK293T) cells: These cells have been successfully used for expression of ELOVL4 and allow for proper protein folding and membrane localization. Transient transfection using lipid-based reagents (such as Lipofectamine) with plasmids containing the full-length monkey ELOVL4 cDNA under a strong promoter (e.g., CMV) has yielded functional protein .

  • COS-7 cells: These African green monkey kidney cells provide a primate cellular environment suitable for monkey protein expression and have been used in studies examining the localization and function of ELOVL proteins .

What methodological approaches can be used to assess the enzymatic activity of recombinant ELOVL4?

Several methodological approaches can be employed to assess the enzymatic activity of recombinant Macaca fascicularis ELOVL4:

  • Radioactive substrate incorporation assay: This approach utilizes radio-labeled fatty acid substrates (e.g., [14C]-labeled fatty acids) to measure elongation activity. Cells expressing recombinant ELOVL4 are incubated with labeled substrates, and the resulting elongated products are extracted, separated by thin-layer chromatography or gas chromatography, and quantified by scintillation counting .

  • Gas chromatography-mass spectrometry (GC-MS): This method allows for precise identification and quantification of fatty acid products. Cells expressing recombinant ELOVL4 are incubated with potential substrates, and the fatty acid products are extracted, derivatized (typically as methyl esters), and analyzed by GC-MS to determine chain length and degree of unsaturation .

  • Liquid chromatography-tandem mass spectrometry (LC-MS/MS): This approach offers high sensitivity and specificity for detecting and quantifying VLC-PUFAs and VLC-SFAs. It is particularly useful for analyzing complex lipid mixtures and can provide detailed information about the incorporation of elongated fatty acids into different lipid classes .

  • In vitro microsomal assays: Microsomes isolated from cells expressing recombinant ELOVL4 can be used in cell-free assays with appropriate cofactors (malonyl-CoA, NADPH, etc.) to measure direct enzymatic activity without cellular complications .

When implementing these methods, it's crucial to include proper controls, such as microsomes or cells expressing empty vector or enzymatically inactive ELOVL4 mutants, to account for background activity from endogenous elongases.

How can researchers effectively distinguish between VLC-PUFA and VLC-SFA biosynthesis when studying recombinant ELOVL4 function?

Distinguishing between VLC-PUFA and VLC-SFA biosynthesis when studying recombinant ELOVL4 requires careful experimental design and analytical techniques:

  • Substrate selection: To evaluate VLC-PUFA synthesis, provide polyunsaturated precursors such as DHA (22:6n-3) or arachidonic acid (20:4n-6). For VLC-SFA synthesis, provide saturated precursors like palmitic acid (16:0) or stearic acid (18:0) .

  • Analytical separation techniques: Employ chromatographic techniques that can effectively separate fatty acids based on both chain length and degree of unsaturation. Silver-ion high-performance liquid chromatography (Ag⁺-HPLC) is particularly useful for separating fatty acids with different numbers of double bonds .

  • Mass spectrometry fragmentation patterns: Use characteristic fragmentation patterns in mass spectrometry to distinguish between saturated and polyunsaturated very long-chain fatty acids based on their molecular ions and fragment ions .

  • Tissue-specific expression systems: Given that ELOVL4 produces VLC-PUFAs in retina and brain but VLC-SFAs in skin and Meibomian glands, co-expression with tissue-specific factors may help recapitulate these differences in vitro. Consider co-expressing retinal-specific or skin-specific transcription factors or cofactors along with recombinant ELOVL4 .

  • Metabolic labeling with stable isotopes: Use deuterium or 13C-labeled precursors that specifically trace either the saturated or polyunsaturated elongation pathways, allowing for precise tracking of the metabolic fate of each substrate class .

By implementing these approaches, researchers can effectively distinguish between the two major products of ELOVL4 enzymatic activity and investigate the tissue-specific factors that influence substrate preference.

What experimental models are most appropriate for studying the functional consequences of ELOVL4 mutations?

Several experimental models are suitable for investigating the functional consequences of ELOVL4 mutations, each with distinct advantages for specific research questions:

Selection of the appropriate model should be guided by the specific mutation being studied and the tissue-specific effects of interest, as ELOVL4 mutations can affect the retina, brain, and skin differently .

What techniques can be used to analyze the incorporation of ELOVL4-derived fatty acids into complex lipids?

To analyze the incorporation of ELOVL4-derived fatty acids into complex lipids, researchers can employ several sophisticated analytical techniques:

  • Lipidomics approaches using LC-MS/MS: This technique allows for comprehensive profiling of complex lipids containing VLC-PUFAs or VLC-SFAs. Multiple reaction monitoring (MRM) can be used to target specific lipid species containing ELOVL4-derived fatty acids .

  • Phospholipid class separation: Prior to analysis of fatty acid composition, total lipid extracts can be separated into individual phospholipid classes (phosphatidylcholine, phosphatidylethanolamine, phosphatidylserine, etc.) using normal-phase HPLC or thin-layer chromatography. This approach reveals which phospholipid classes preferentially incorporate ELOVL4 products .

  • Metabolic labeling with stable isotopes: Incubating cells or tissues with isotopically labeled fatty acid precursors allows tracking of ELOVL4-mediated elongation and subsequent incorporation into complex lipids over time .

  • Molecular species analysis: This approach identifies the precise positioning of ELOVL4-derived fatty acids within complex lipids (e.g., sn-1 vs. sn-2 position in phospholipids) using position-specific enzymatic hydrolysis followed by mass spectrometry .

  • Imaging mass spectrometry: This technique provides spatial information about the distribution of lipids containing ELOVL4-derived fatty acids within tissues, which is particularly valuable for heterogeneous tissues like retina .

These methods can reveal how ELOVL4-derived VLC-PUFAs and VLC-SFAs are incorporated into membrane phospholipids and other complex lipids, providing insights into their structural roles and potential signaling functions in different cellular compartments.

How can researchers investigate the impact of ELOVL4 expression on membrane properties and cellular function?

Investigating the impact of ELOVL4 expression on membrane properties and cellular function requires a multidisciplinary approach combining biophysical techniques with functional assays:

  • Membrane fluidity measurements: Techniques such as fluorescence anisotropy, fluorescence recovery after photobleaching (FRAP), or electron spin resonance (ESR) spectroscopy can assess how VLC-FA incorporation affects membrane fluidity and organization. VLC-PUFAs may increase membrane fluidity in certain domains, while VLC-SFAs may create more ordered membrane regions .

  • Lipid raft analysis: Detergent-resistant membrane fractionation or super-resolution microscopy can determine how ELOVL4-derived fatty acids affect the composition and properties of lipid rafts, which are important for membrane protein organization and signaling .

  • Electrophysiological recordings: In neuronal or retinal cells, patch-clamp recordings can assess how ELOVL4 expression and the resulting changes in membrane lipid composition affect membrane electrical properties, ion channel function, and synaptic transmission. In the brain, VLC-SFAs are enriched in synaptic vesicles and mediate neuronal signaling by determining the rate of neurotransmitter release .

  • Calcium imaging: This approach can reveal how ELOVL4 expression affects calcium signaling dynamics, which are closely linked to membrane properties and are essential for many cellular functions including neurotransmission and phototransduction .

  • Membrane protein trafficking and function: Immunofluorescence microscopy and biochemical assays can assess how changes in membrane lipid composition affect the localization, trafficking, and function of membrane proteins, particularly those involved in phototransduction in photoreceptor cells .

  • Permeability barrier function: For skin cells, transepithelial electrical resistance (TEER) measurements and permeability assays can evaluate how ELOVL4-derived VLC-SFAs contribute to the skin permeability barrier .

By combining these approaches, researchers can comprehensively characterize how ELOVL4 expression and its lipid products influence membrane biophysical properties and the resulting effects on cellular function in different tissues.

What approaches can be used to identify potential binding partners and regulatory factors of ELOVL4?

Identifying ELOVL4's binding partners and regulatory factors is crucial for understanding its regulation and tissue-specific functions. Several complementary approaches can be employed:

  • Co-immunoprecipitation (Co-IP) coupled with mass spectrometry: This approach can identify proteins that physically interact with ELOVL4. Using recombinant tagged ELOVL4 (HA-tag, FLAG-tag, etc.) expressed in relevant cell types, researchers can pull down ELOVL4 and its associated proteins, followed by mass spectrometric identification .

  • Proximity labeling techniques: Methods such as BioID or APEX2, where a promiscuous biotin ligase is fused to ELOVL4, allow for biotinylation of proximal proteins in living cells. This approach is particularly valuable for identifying transient interactions and partners of membrane proteins like ELOVL4 .

  • Yeast two-hybrid screening: Despite limitations for membrane proteins, modified membrane-based yeast two-hybrid systems can be used to screen for interactions between ELOVL4 domains and potential partners .

  • Cross-linking mass spectrometry: Chemical cross-linking followed by mass spectrometry can capture and identify proteins in close proximity to ELOVL4 in its native environment .

  • Transcription factor binding analysis: Chromatin immunoprecipitation (ChIP) assays can identify transcription factors that bind to the ELOVL4 promoter region and regulate its expression in different tissues, explaining its tissue-specific expression pattern .

  • Proteomics analysis of tissue-specific ELOVL4 complexes: Comparing ELOVL4-associated proteins between retina, brain, and skin may reveal tissue-specific factors that direct ELOVL4 toward VLC-PUFA versus VLC-SFA synthesis .

  • Functional genomics screens: CRISPR-based knockout or RNAi screens can identify genes that, when disrupted, affect ELOVL4 expression, localization, or activity, potentially revealing regulatory pathways .

These approaches can help uncover the molecular mechanisms underlying ELOVL4's tissue-specific functions and substrate preferences.

How can recombinant Macaca fascicularis ELOVL4 be used to develop therapeutic strategies for ELOVL4-related disorders?

Recombinant Macaca fascicularis ELOVL4 offers several avenues for developing therapeutic strategies for ELOVL4-related disorders:

  • High-throughput screening platforms: Recombinant monkey ELOVL4 can be used in cell-based assays to screen for small molecules that might enhance the activity of wild-type ELOVL4 in heterozygous mutation carriers or stabilize mutant ELOVL4 protein .

  • Gene therapy development: The high homology between monkey and human ELOVL4 makes Macaca fascicularis ELOVL4 a suitable template for developing gene therapy approaches. Preclinical testing of gene delivery vectors (AAV, lentivirus) carrying wild-type ELOVL4 can be evaluated in appropriate disease models .

  • Structure-based drug design: Although the crystal structure of ELOVL4 has not been reported, homology modeling based on the conserved sequence of monkey ELOVL4 could guide rational design of small molecules that bind to and stabilize mutant ELOVL4 or enhance wild-type function .

  • Lipid replacement therapy: Characterization of specific VLC-PUFAs or VLC-SFAs produced by recombinant monkey ELOVL4 can inform the development of lipid supplementation approaches to compensate for deficiencies in patients with ELOVL4 mutations .

  • Cell therapy optimization: Understanding the optimal conditions for ELOVL4 expression and function can guide the development of cell-based therapies, such as transplantation of cells engineered to express functional ELOVL4 .

  • Biomarker development: Recombinant ELOVL4 can help establish comprehensive lipid profiles associated with normal ELOVL4 function, which can serve as biomarkers for monitoring disease progression and treatment response .

The close evolutionary relationship between Macaca fascicularis and human ELOVL4 makes the monkey protein an ideal model for translational research aimed at human ELOVL4-related disorders .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.