Recombinant Macaca fascicularis Estradiol 17-beta-dehydrogenase 12 (HSD17B12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HSD17B12; QnpA-11752; Very-long-chain 3-oxoacyl-CoA reductase; 17-beta-hydroxysteroid dehydrogenase 12; 17-beta-HSD 12; 3-ketoacyl-CoA reductase; KAR; Estradiol 17-beta-dehydrogenase 12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
HSD17B12
Target Protein Sequence
MESALPAAGFLYWVGAGTVAYLALRISYSLFTALRVWGVGNEAGVGPGLGEWAVVTGGTD GIGKSYAEELAKRGMKVVLISRSQDKLDQVSSEIKEKFKVETRTIAVDFTLEDIYDKIKT GLAGLEIGILVNNVGMSYEYPEYFLDVPDLDNVIKKMININILSVCKMTQLVLPGMVERS KGAILNISSGSGMFPVPLLTIYSATKTFVDFFSQCLHEEYRSKGIFVQSVLPYFVATKLA KIRKPTLDKPTPETFVKSAIKTVGLQSRTNGYLIHVLMGWIISNLPSWIYLKIAMNMNKA TRVHYLKKIKKN
Uniprot No.

Target Background

Function

Recombinant Macaca fascicularis Estradiol 17-beta-dehydrogenase 12 (HSD17B12)

This enzyme catalyzes the second reaction in the four-step long-chain fatty acid elongation cycle. This endoplasmic reticulum-bound process adds two carbons per cycle to long- and very long-chain fatty acids (VLCFAs). HSD17B12 exhibits 3-ketoacyl-CoA reductase activity, reducing 3-ketoacyl-CoA to 3-hydroxyacyl-CoA during each elongation cycle. This function contributes to VLCFA synthesis of varying chain lengths, which serve as precursors for membrane lipids and lipid mediators. Additionally, HSD17B12 may catalyze estrone (E1) conversion to estradiol (E2), indicating a potential role in estrogen biosynthesis.

Database Links

UniGene: Mfa.8323

Protein Families
Short-chain dehydrogenases/reductases (SDR) family, 17-beta-HSD 3 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the basic function of HSD17B12 in Macaca fascicularis?

HSD17B12 in Macaca fascicularis (mf17β-HSD12) primarily functions as an estrogen-specific 17β-hydroxysteroid dehydrogenase that efficiently and selectively catalyzes the transformation of estrone (E1) into estradiol (E2), similar to its human counterpart. Experimental verification through HEK-293 cells stably expressing mf17β-HSD12 has confirmed this enzymatic specificity, with minimal activity toward other conversions such as androstenedione to testosterone .

The enzyme appears to be an essential partner of aromatase in estradiol biosynthesis, suggesting that in the estradiol biosynthesis pathway, 17-ketoreduction follows aromatization (i.e., androstenedione is first converted to estrone by aromatase, followed by conversion of estrone to estradiol by estrogen-specific 17β-HSDs) .

Additionally, like its human counterpart, mf17β-HSD12 also plays a role in fatty acid metabolism, particularly in the elongation of very long chain fatty acids (VLCFAs) .

What is the tissue distribution pattern of HSD17B12 in Macaca fascicularis?

Quantitative Real-Time PCR analysis reveals that mf17β-HSD12 mRNA is widely expressed across Macaca fascicularis tissues, with varying expression levels:

TissueRelative Expression Level
CerebellumHigh
SpleenHigh
AdrenalHigh
TestisModerate
OvaryModerate
Cerebral cortexModerate
LiverModerate
HeartModerate
ProstateModerate
Mammary glandModerate
MyometriumModerate
EndometriumModerate
SkinModerate
MuscleModerate
PancreasModerate

This ubiquitous expression pattern suggests that HSD17B12 plays important roles across multiple tissues and is likely a key enzyme involved in estradiol biosynthesis throughout the body .

How can in situ hybridization be optimized to visualize HSD17B12 expression in specific tissues?

For optimal in situ hybridization to visualize HSD17B12 expression in specific tissues, the following methodological approach has been validated in research:

  • Probe preparation: Generate a 35S-labeled cRNA probe specific to mf17β-HSD12 mRNA. This provides high sensitivity for detecting expression in tissue sections.

  • Tissue preparation: Process fresh tissue samples from target organs (e.g., mammary gland, uterus) through proper fixation and sectioning protocols.

  • Hybridization protocol:

    • Perform hybridization with the radiolabeled antisense probe

    • Include consecutive sections hybridized with sense probes as negative controls

    • Optimize hybridization temperature and washing conditions to reduce background

  • Signal detection and analysis: Visualize and quantify the hybridization signal to determine cellular localization.

Using this approach, researchers have successfully demonstrated that in the mammary gland, HSD17B12 mRNA expression occurs in both epithelial cells of the alveoli and stromal cells. In the uterus, expression is detected in epithelial and stromal cells of the endometrium, and in the uterine cervix, expression is observed in squamous epithelium and stromal cells .

What expression systems are most effective for producing recombinant Macaca fascicularis HSD17B12?

Based on published research, E. coli has been demonstrated as an effective expression system for producing recombinant Macaca fascicularis HSD17B12. The methodology for optimal expression includes:

  • Vector selection: The full-length protein coding sequence (amino acids 1-312) can be cloned into a suitable expression vector with an N-terminal His-tag for purification purposes.

  • Expression conditions:

    • Temperature, inducer concentration, and expression duration should be optimized

    • For E. coli systems, IPTG induction at lower temperatures (16-20°C) often improves soluble protein yield

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC) using His-tag

    • Buffer optimization to maintain enzyme stability (Tris-based buffers with glycerol)

    • Consider adding protease inhibitors during cell lysis

  • Storage considerations:

    • Store at -20°C/-80°C upon receipt

    • Aliquot to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

    • Lyophilized protein can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol (final concentration) is recommended for long-term storage

Mammalian cell lines such as HEK-293 have also been successfully used for expressing functional mf17β-HSD12, particularly when studying enzymatic activity in intact cells .

How can the enzymatic activity of recombinant Macaca fascicularis HSD17B12 be effectively measured?

To effectively measure the enzymatic activity of recombinant Macaca fascicularis HSD17B12, the following methodological approach has been validated:

  • Cell-based assay system:

    • Establish HEK-293 cells stably expressing mf17β-HSD12

    • Incubate cells with radioactive or non-radioactive substrates (e.g., [3H]-estrone)

    • Measure conversion rates without addition of exogenous cofactors, as intact cells provide the necessary NADPH

  • Reaction conditions:

    • Substrate concentration: Optimize based on enzyme kinetics (typically in the nanomolar range for radioactive substrates)

    • Incubation time: Monitor time-dependent conversion (up to 50 hours may be needed to observe complete conversion)

    • Temperature: Typically performed at 37°C

  • Analysis methods:

    • For radioactive substrates: Separation by thin-layer chromatography followed by autoradiography

    • For non-radioactive substrates: LC-MS/MS analysis

  • Data interpretation:

    • Calculate conversion percentages

    • Determine substrate specificity by comparing conversion rates with different substrates (estrone, androstenedione, estradiol, testosterone)

    • Assess time-dependent conversion to ensure linearity

Using this methodology, researchers have demonstrated that mf17β-HSD12 catalyzes predominantly the transformation of estrone into estradiol, with negligible conversion of androstenedione to testosterone, estradiol to estrone, or testosterone to androstenedione .

How does HSD17B12 contribute to lipid metabolism beyond its role in steroid conversion?

Beyond its steroid-converting function, HSD17B12 plays a crucial role in lipid metabolism, particularly in fatty acid elongation processes. Research using knockout mouse models reveals its multifaceted contributions:

  • Very long chain fatty acid (VLCFA) elongation:

    • HSD17B12 functions as a 3-ketoacyl-CoA reductase in the endoplasmic reticulum

    • It catalyzes the second step in fatty acid elongation cycle, particularly in producing arachidonic acid

    • Knockout studies indicate its role in generating specific lipid species that contain fatty acids with carbon chain lengths of 18 and 20 atoms

  • Lipid droplet formation and expansion:

    • Hepatocyte-specific knockout of HSD17B12 (LiB12cKO) leads to defects in lipid droplet expansion

    • This results in microvesicular steatosis rather than macrovesicular steatosis

    • The defect appears associated with decreased quantities of phosphatidylcholine and phosphatidylethanolamine containing C18 and C20 fatty acids, which are crucial for lipid droplet formation

  • Metabolic homeostasis:

    • Global HSD17B12 conditional knockout (HSD17B12cKO) in adult mice leads to:

      • 20% reduction in body weight within 6 days

      • Drastic reduction in white (83% males, 75% females) and brown (60-65%) fat

      • Reduced food and water intake

      • Signs of liver toxicity with microvesicular hepatic steatosis

      • Elevated inflammatory markers

These findings demonstrate that HSD17B12 is essential for maintaining proper lipid homeostasis, and its deficiency can rapidly lead to severe metabolic dysregulation and inflammation .

What is the relationship between HSD17B12 function and ceramide metabolism based on knockout studies?

Research using conditional knockout mouse models has revealed an intricate relationship between HSD17B12 and ceramide metabolism:

These findings indicate that HSD17B12 plays a critical role in ceramide metabolism, particularly in maintaining the proper balance of ceramide species with different fatty acid chain lengths, which is essential for normal metabolic function and prevention of inflammation .

What evidence indicates a role for HSD17B12 in cancer progression?

Research has identified several lines of evidence linking HSD17B12 to cancer progression:

  • Association with clinical outcomes:

    • HSD17B12 overexpression has been associated with poor clinical outcomes in invasive ductal carcinoma of the breast

    • Similar associations have been observed in ovarian carcinoma

  • Functional impacts in cancer cells:

    • siRNA knockdown of HSD17B12 in cancer cell lines affects tumor cell growth

    • The enzyme may influence cancer cell survival through altered Annexin V binding, suggesting effects on apoptotic pathways

  • Potential mechanisms:

    • Role in estradiol production: Local estrogen production mediated by HSD17B12 may promote hormone-dependent cancer growth

    • Altered lipid metabolism: Changes in fatty acid composition may influence cancer cell membrane properties, signaling pathways, and energy metabolism

    • Arachidonic acid metabolism: HSD17B12's role in arachidonic acid production may affect inflammatory processes that contribute to cancer progression

  • Tissue-specific expression in hormone-sensitive tissues:

    • The expression of HSD17B12 in mammary gland epithelial and stromal cells correlates with estrogen's known role in mammary development and potentially in breast cancer progression

    • Similar expression patterns in endometrial cells may have implications for endometrial cancers

These findings suggest that HSD17B12 could be a potential therapeutic target in certain cancers, particularly those that are hormone-dependent or show altered lipid metabolism .

How does hepatocyte-specific knockout of HSD17B12 affect non-alcoholic fatty liver disease progression?

Hepatocyte-specific knockout of HSD17B12 (LiB12cKO) significantly impacts non-alcoholic fatty liver disease (NAFLD) progression in distinctive ways:

  • Liver morphology and fat accumulation:

    • LiB12cKO mice develop significantly larger livers compared to control mice across different age groups

    • In 2-month-old mice, the liver size increase is already notable (males: 2.11-fold, p≤.001; females: 1.57-fold, p=.001)

    • By 6 months, the difference becomes even more pronounced (males: 2.31-fold, p≤.001; females: 1.65-fold, p=.002)

    • The enlargement persists at 8 months (males: 1.51-fold, p=.001)

  • Unique steatosis pattern:

    • LiB12cKO mice develop a distinct pattern of fat accumulation in the liver characterized by microvesicular steatosis rather than typical macrovesicular steatosis

    • This indicates a failure in lipid droplet expansion despite increasing fat content

    • This pattern is associated with a defect in lipid droplet biogenesis and growth

  • Molecular mechanisms:

    • Decreased quantities of specific lipid species containing C18 and C20 fatty acids, including oleic acid

    • Reduction in phosphatidylcholine and phosphatidylethanolamine, which are crucial for lipid droplet formation

    • Increased expression of Cidec, supporting the deficiency in lipid droplet expansion

    • Downregulation of several members of the major urinary protein family, which are altered during endoplasmic reticulum stress

  • Progressive metabolic changes:

    • As LiB12cKO mice age, they show reduced whole-body fat percentage despite liver fat accumulation

    • In males, improved glucose tolerance is observed, suggesting complex metabolic adaptations

    • The progression indicates that HSD17B12 deficiency leads to a slow decrease in body weight concurrent with NAFLD development

These findings suggest that HSD17B12 plays a crucial role in hepatic lipid metabolism, and its deficiency creates a unique form of NAFLD characterized by microvesicular steatosis and defective lipid droplet expansion that could serve as a valuable research model for this specific pathophysiology .

How conserved is HSD17B12 across species and what are the functional implications?

Analysis of HSD17B12 across species reveals significant evolutionary conservation with important functional implications:

  • Sequence conservation:

    • Macaca fascicularis HSD17B12 shows high sequence identity with other species:

      • Human: 95% identity

      • Cow: 82% identity

      • Mouse: 81% identity

      • Rat: 78% identity

      • Duck: 66% identity

    • This high conservation suggests critical biological functions maintained through evolution

  • Conserved functional domains:

    • The putative YXXXK active center and modified GXXXGXL cofactor binding site characteristic of the short-chain dehydrogenase/reductase (SDR) family are preserved across species

    • These conserved signatures highlight evolutionary pressure to maintain specific catalytic activities

  • Functional conservation:

    • Enzymatic activity studies show that both human and Macaca fascicularis HSD17B12 efficiently catalyze the conversion of estrone to estradiol

    • Similar roles in fatty acid elongation have been identified across mammalian species

    • The dual function (steroid metabolism and fatty acid elongation) appears to be conserved, suggesting fundamental metabolic importance

  • Tissue expression patterns:

    • The widespread tissue distribution observed in Macaca fascicularis is similar to the universal expression pattern described in humans and mice

    • This conservation of expression patterns further supports the enzyme's essential role across species

The high degree of conservation of HSD17B12 across species suggests that this enzyme plays fundamental roles in both steroid metabolism and lipid homeostasis that have been maintained throughout evolution. This conservation provides researchers with valuable comparative models to study HSD17B12 function and its implications for human health and disease .

How can interspecies differences in HSD17B12 be leveraged in translational research?

Interspecies differences in HSD17B12 provide valuable opportunities for translational research:

  • Model selection strategies:

    • The 95% sequence identity between human and Macaca fascicularis HSD17B12 makes cynomolgus monkeys excellent translational models for human studies

    • For more divergent research questions, the greater evolutionary distance in rodent models (81% identity with mouse) can highlight essential vs. accessory functions of the enzyme

    • Each species model offers complementary insights: primate models for high translational value, rodent models for genetic manipulation and mechanistic studies

  • Functional differences as research tools:

    • Subtle variations in enzymatic kinetics or substrate specificity between species can illuminate critical amino acid residues or structural domains

    • Comparative studies can reveal species-specific adaptations in lipid metabolism or steroid hormone regulation

    • These differences can guide rational drug design targeting specific functional domains while avoiding others

  • Practical research applications:

    • For studying estrogen metabolism: Macaca fascicularis models offer high translational value with enzymatic properties closely matching human HSD17B12

    • For lipid metabolism studies: Mouse knockout models provide powerful tools to investigate tissue-specific functions, with findings generally applicable to humans due to conserved metabolic pathways

    • For structure-function analyses: Multiple species comparisons can identify invariant regions critical for function versus variable regions that may tolerate modifications

  • Optimizing experimental design:

    • When designing inhibitors or modulators of HSD17B12 activity, researchers should test across species to identify compounds with consistent effects

    • For reproductive endocrinology studies, primate models may provide superior translation to human applications

    • For basic metabolism research, the easier genetic manipulation of mouse models offers advantages despite greater evolutionary distance

By strategically leveraging these interspecies differences, researchers can develop more robust experimental designs and improve the translational value of their findings, ultimately enhancing our understanding of HSD17B12's role in human health and disease .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.