Recombinant Macaca fascicularis Fatty acid 2-hydroxylase (FA2H)

Shipped with Ice Packs
In Stock

Description

Recombinant Macaca fascicularis Fatty Acid 2-Hydroxylase (FA2H): Overview

Recombinant Macaca fascicularis FA2H is a bioengineered protein derived from the crab-eating macaque (Macaca fascicularis), designed to replicate the enzymatic activity of fatty acid 2-hydroxylase (FA2H). This enzyme catalyzes the hydroxylation of fatty acids at the α-position (C-2), a critical step in synthesizing 2-hydroxylated sphingolipids, which are essential for myelin integrity in the central and peripheral nervous systems . The recombinant form is produced via expression in mammalian or bacterial systems (e.g., HEK293 cells or E. coli) and is widely used in research, diagnostics, and therapeutic development .

Applications in Research and Diagnostics

Recombinant Macaca fascicularis FA2H is utilized in diverse experimental and clinical settings:

ApplicationDescriptionSource
ImmunoassaysDetection of FA2H antibodies using pre-coupled magnetic beads for high-throughput screening .
Cell SortingIsolation of FA2H-expressing cells via magnetic bead-based separation .
Protein PurificationAffinity chromatography or immunoprecipitation to isolate FA2H or interacting proteins .
ELISA DevelopmentProduction of anti-FA2H antibodies for quantifying enzyme levels in biological samples .

Role in Sphingolipid Metabolism

  • Myelin Synthesis: FA2H-deficient models (e.g., Drosophila) exhibit demyelination, motor deficits, and shortened lifespan, underscoring its role in maintaining neural white matter .

  • 2-OH Sphingolipid Biosynthesis: Recombinant FA2H enables in vitro production of 2-hydroxy ceramides (C16, C18, C24, C24:1) and fatty acids, critical for lipid raft formation and membrane stability .

Disease Association

Mutations in FA2H are linked to fatty acid hydroxylase-associated neurodegeneration (FAHN) and hereditary spastic paraplegia type 35 (SPG35) . Recombinant FA2H studies highlight:

  • Iron Accumulation: FA2H dysfunction correlates with brain iron deposition, though mechanisms remain unclear .

  • Enzyme Activity Variability: Partially functional mutants (e.g., p.Val149Leu) may predict milder phenotypes, though clinical outcomes are inconsistent .

Genetic and Biochemical Context

The FA2H gene in Macaca fascicularis (Gene ID: 101865555) shares high homology with human FA2H, encoding a 372-amino acid protein with conserved functional domains . Key identifiers include:

  • mRNA RefSeq: NM_001283683

  • Protein RefSeq: NP_001270612

  • UniProt ID: Q4R4P4 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
FA2H; FAAH; QtrA-13193; Fatty acid 2-hydroxylase; Fatty acid alpha-hydroxylase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-372
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
FA2H
Target Protein Sequence
MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISA DLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEAVALEETQKTDPAMEPRFKVVDWD KDLVDWQKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGLSKTVWYSVPIIWVPLV LYLSWSYYRTFAQGNVRLFTSFTTEYALAVPKSMFPGLFMLGIFLWSLIEYLIHRFLFHM KPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCLQLILPEAVGGTV FAGGLLGYVLYDMTHYYLHFGSPHRGSYLYNLKAHHVKHHFAHQKSGFGISTKLWDYCFH TLIPEKPHLKTQ
Uniprot No.

Target Background

Function

Recombinant Macaca fascicularis Fatty acid 2-hydroxylase (FA2H) catalyzes the hydroxylation of free fatty acids at the C-2 position, producing 2-hydroxy fatty acids. These are crucial building blocks of sphingolipids and glycosphingolipids, prevalent in neural tissue and epidermis. FA2H exhibits stereospecificity for the production of (R)-2-hydroxy fatty acids. It plays a vital role in galactosphingolipid synthesis within the myelin sheath and is responsible for the synthesis of sphingolipids and glycosphingolipids integral to the formation of epidermal lamellar bodies, which are critical for maintaining the skin's permeability barrier. Furthermore, FA2H participates in the synthesis of glycosphingolipids and a portion of type II wax diesters in sebaceous glands, specifically regulating hair follicle homeostasis. Its involvement in the synthesis of sphingolipids within plasma membrane rafts influences lipid raft mobility and the trafficking of raft-associated proteins.

Database Links

KEGG: mcf:101865555

UniGene: Mfa.3013

Protein Families
Sterol desaturase family, SCS7 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Microsome membrane; Multi-pass membrane protein.

Q&A

What is the basic function of FA2H in primate neural systems?

Fatty acid 2-hydroxylase (FA2H) catalyzes the 2-hydroxylation of fatty acids during de novo ceramide synthesis, producing 2-hydroxysphingolipids that are abundantly present in the brain. These 2-hydroxysphingolipids are critical components of myelin, particularly galactosylceramides and sulfatides. In primates, including Macaca fascicularis, FA2H plays an essential role in maintaining myelin integrity and function, thereby supporting normal neuronal signaling. The enzyme specifically introduces a hydroxyl group at the C2 position of fatty acids incorporated into sphingolipids, which affects membrane properties and intercellular interactions within neural tissues. Research indicates that this hydroxylation alters the hydrogen bonding capabilities of these lipids, influencing membrane fluidity and stability .

How does the structure of Macaca fascicularis FA2H compare to human FA2H?

While specific structural data comparing Macaca fascicularis FA2H to human FA2H is limited in the provided search results, homology across primates is typically high for conserved enzymatic proteins. Human FA2H consists of 372 amino acids with characteristic domains including an N-terminal cytochrome b5 domain and four transmembrane domains. The protein also contains iron-binding histidine motifs conserved among membrane-bound desaturases/hydroxylases. The functional domains of primate FA2H are expected to show high conservation given their essential role in myelin formation. The N-terminal cytochrome b5 domain is particularly critical, as studies have demonstrated that FA2H lacking this domain exhibits significantly reduced enzymatic activity .

What are the key domains and motifs in FA2H that affect its enzymatic activity?

FA2H contains several critical structural elements that directly influence its enzymatic function:

  • N-terminal cytochrome b5 domain: Essential for full enzymatic activity; deletion of this domain results in drastically reduced hydroxylase function

  • Four transmembrane domains: Enable proper membrane localization and orientation

  • Iron-binding histidine motif: Conserved among membrane-bound desaturases/hydroxylases and crucial for catalytic activity

  • NADPH binding regions: Support the NADPH-dependent hydroxylation reaction

Experimental evidence indicates that FA2H hydroxylase activities are dependent on NADPH and NADPH:cytochrome P-450 reductase. The iron-binding histidine motif is particularly important as it coordinates the iron atom involved in the catalytic mechanism. Mutational studies targeting these domains provide valuable insights into structure-function relationships in FA2H proteins .

What expression systems are most effective for producing recombinant Macaca fascicularis FA2H?

For recombinant expression of Macaca fascicularis FA2H, mammalian expression systems generally yield the most functionally active protein due to proper post-translational modifications and membrane insertion. Based on research practices with human FA2H, COS7 cells have proven effective for expression studies. When expressing recombinant FA2H, vector selection is crucial—pCMV6-Entry vectors with appropriate selection markers (e.g., neomycin for mammalian cells) are commonly used. For higher protein yields, stable cell lines may be preferable over transient transfection .

A methodological approach involves:

  • Cloning the Macaca fascicularis FA2H gene into a mammalian expression vector

  • Transfecting mammalian cells (COS7 or HEK293T)

  • Selecting stable clones using appropriate antibiotics

  • Verifying expression through Western blot analysis using FA2H-specific antibodies

  • Scaling up production in bioreactors if larger quantities are needed

For detailed structural studies requiring higher purity, insect cell expression systems may offer advantages, though functional validation is essential when switching expression platforms.

What purification strategies maintain the enzymatic activity of recombinant FA2H?

Purifying membrane-bound enzymes like FA2H while preserving enzymatic activity presents significant challenges. The most effective purification strategy involves:

  • Careful membrane fractionation: Isolate microsomal fractions from expressing cells using differential centrifugation

  • Detergent selection: Use mild detergents (DDM, CHAPS, or digitonin) at optimized concentrations to solubilize FA2H while maintaining its native conformation

  • Affinity purification: Utilizing epitope tags (Myc-DDK tags are common) for affinity chromatography

  • Buffer optimization: Include glycerol (10-20%) and reducing agents to stabilize the protein

  • Activity preservation: Add NADPH and iron sources during purification steps

Throughout purification, it's critical to verify enzyme activity using functional assays that measure the 2-hydroxylation of fatty acid substrates. Research has shown that microsomal fractions prepared from transfected COS7 cells demonstrating tetracosanoic acid 2-hydroxylase activities require NADPH and NADPH:cytochrome P-450 reductase for functionality .

How can researchers verify the proper folding and membrane integration of recombinant FA2H?

Verification of proper folding and membrane integration of recombinant FA2H involves multiple complementary approaches:

  • Enzymatic activity assays: Measurement of 2-hydroxylation activity using appropriate fatty acid substrates (e.g., tetracosanoic acid)

  • Membrane fractionation analysis: Confirmation that FA2H localizes to the appropriate membrane fraction during cell fractionation

  • Protease protection assays: To determine the topology of membrane insertion

  • Fluorescent protein fusion analysis: Confocal microscopy of FA2H fused with fluorescent proteins to visualize subcellular localization

  • Glycosylation status evaluation: Analysis of post-translational modifications characteristic of properly folded proteins

Experimental evidence from human FA2H expression studies indicates that properly folded and membrane-integrated FA2H should generate 3-20 fold higher levels of 2-hydroxyceramides compared to control cells. These 2-hydroxyceramides include various chain lengths (C16, C18, C24, and C24:1), which can be detected and quantified using liquid chromatography-mass spectrometry techniques .

What are the most reliable assays for measuring FA2H enzymatic activity in vitro?

Several complementary approaches provide robust assessment of FA2H enzymatic activity:

Assay TypeMethodologyAdvantagesLimitations
Microsomal Activity AssayIncubate microsomal fractions with fatty acid substrates, NADPH, and NADPH:P450 reductase; measure 2-hydroxy fatty acid productionPhysiologically relevant; measures direct enzyme activityRequires specialized analytical equipment
LC-MS QuantificationAnalyze 2-hydroxy fatty acids and 2-hydroxyceramides by liquid chromatography-mass spectrometryHigh sensitivity and specificity; quantitativeExpensive; requires technical expertise
Radiolabeled Substrate AssayUse 14C-labeled fatty acids as substrates; separate and quantify hydroxylated productsHigh sensitivity; well-establishedRequires radioisotope handling facilities
Cellular 2-Hydroxyceramide ProductionMeasure accumulation of 2-hydroxyceramides in cells expressing recombinant FA2HAssesses activity in cellular contextIndirect measure; influenced by other cellular factors

The most definitive assay combines microsomal fractions with appropriate co-factors (NADPH and NADPH:cytochrome P-450 reductase) and measures the conversion of specific fatty acids like tetracosanoic acid to their 2-hydroxylated derivatives. Research has demonstrated that properly functioning FA2H should yield significant increases in 2-hydroxylated products compared to control preparations .

How do mutations in the cytochrome b5 domain affect FA2H function in experimental models?

Mutations or deletions in the N-terminal cytochrome b5 domain dramatically impair FA2H enzymatic activity. Experimental evidence from human FA2H studies demonstrates that constructs lacking this domain exhibit minimal hydroxylase activity. The cytochrome b5 domain functions as an electron transfer component, facilitating the redox reactions necessary for hydroxylation.

In experimental models, specific mutations to watch for include:

  • Disruptions to heme-binding residues within the cytochrome b5 domain

  • Mutations affecting the interface between the cytochrome b5 domain and the catalytic domain

  • Alterations to the linker region connecting these domains

When introducing these mutations in recombinant Macaca fascicularis FA2H, researchers should expect:

  • Reduced 2-hydroxylation activity proportional to the severity of the mutation

  • Altered affinity for NADPH:cytochrome P-450 reductase

  • Potential changes in substrate specificity profiles

For comprehensive mutation analysis, both in vitro activity assays and cellular expression studies should be employed to characterize the functional consequences of these mutations .

What substrate specificity does FA2H exhibit, and how can it be experimentally determined?

FA2H exhibits substrate preferences for certain fatty acid chain lengths, though it generally acts on long-chain fatty acids. To experimentally determine the substrate specificity of recombinant Macaca fascicularis FA2H:

  • Competitive substrate assays: Provide multiple fatty acid substrates simultaneously and measure relative conversion rates

  • Kinetic parameter determination: Calculate Km and Vmax values for different fatty acid substrates

  • Structure-activity relationship studies: Test modified fatty acids to determine essential features for substrate recognition

  • Cellular lipid profiling: Analyze the profile of 2-hydroxyceramides produced in cells expressing recombinant FA2H

Human FA2H studies have shown activity toward various fatty acids, generating 2-hydroxyceramides with different chain lengths (C16, C18, C24, and C24:1). Researchers should expect similar but potentially distinct substrate preferences in Macaca fascicularis FA2H, which can be characterized through detailed enzymatic analysis. The substrate specificity profile provides valuable insights into the physiological role of FA2H in lipid metabolism and myelin formation .

How do FA2H knockout models replicate neurological disease phenotypes?

FA2H knockout models demonstrate progressive neurological deterioration that parallels aspects of fatty acid hydroxylase-associated neurodegeneration (FAHN) in humans. Key neurological phenotypes observed in these models include:

  • Seizure development: LRRC8A-null mice (which affect pathways related to FA2H function) display seizure phenotypes confirmed by video-EEG recordings, with >95% mortality between 5-9 weeks of age

  • Excitability disruptions: Electrophysiology experiments reveal disruptions in cell excitability and GABAergic signaling in the hippocampus

  • Astrogliosis: Reactive astrogliosis occurs progressively with disease development

  • Neurotransmitter alterations: Reductions in total tissue glutamine levels and decreased immunoreactivity of astrocytic glutamine synthetase, GLT-1 (glutamate transporter), and GAT-1 (GABA transporter)

  • Motor impairments: Drosophila models with loss of dfa2h exhibit behavioral abnormalities including motor impairment and flying disability, along with shortened lifespan

These models suggest that FA2H deficiency leads to complex neurological consequences involving glial cells, neurotransmitter systems, and myelin integrity. The progressive nature of these phenotypes makes these models valuable for investigating disease mechanisms and potential therapeutic interventions .

What cellular mechanisms are disrupted in FA2H deficiency models?

FA2H deficiency disrupts multiple cellular pathways critical for normal neurological function:

  • Myelin structure and stability: Primary effect due to lack of 2-hydroxysphingolipids in myelin sheaths

  • Mitochondrial dynamics: Alterations observed in Drosophila models suggest disrupted mitochondrial function

  • Autophagy pathways: Evidence from Drosophila models indicates dysregulated autophagy processes

  • Neuron-glia interactions: Disrupted signaling between neurons and glial cells

  • Neurotransmitter homeostasis: Altered glutamate and GABA levels and transport

These disruptions manifest as progressive neurological deterioration. Research in patient-derived fibroblasts confirms the evolutionary conservation of these cellular mechanisms, making animal models relevant for understanding human disease. The connection between sphingolipid composition and these diverse cellular functions reveals the complex role of FA2H in maintaining neural system homeostasis .

How do FA2H enzymatic assays differ between normal and disease state models?

Enzymatic assays comparing normal and disease state models reveal distinctive differences:

ParameterNormal FA2HDisease Model FA2HDetection Method
2-Hydroxylation ActivityHigh; 3-20 fold above backgroundReduced or absentLC-MS quantification of 2-hydroxy fatty acids
Substrate SpecificityBroad range of long-chain fatty acidsMay show altered preference patternsCompetitive substrate assays
NADPH DependencyStrong dependencyMay show altered cofactor requirementsActivity assays with varying NADPH concentrations
Subcellular LocalizationProper membrane integrationPotential mislocalizationSubcellular fractionation; immunofluorescence
Product ProfileNormal distribution of 2-hydroxyceramidesAltered ceramide compositionLipidomic analysis

When analyzing disease-associated FA2H variants, researchers should employ comprehensive enzymatic characterization to determine the specific biochemical defects. Some mutations may affect protein stability rather than catalytic activity, necessitating expression level analysis alongside activity measurements. Other mutations may alter substrate specificity or reduce catalytic efficiency without eliminating activity entirely. These nuanced enzymatic profiles help explain the variable clinical presentations in FAHN patients and provide insights for targeted therapeutic approaches .

What evolutionary conservation exists between Macaca fascicularis FA2H and other mammalian FA2H proteins?

While the search results don't provide specific sequence comparisons for Macaca fascicularis FA2H, the evolutionary conservation patterns among mammalian FA2H proteins follow predictable patterns. Human FA2H shows approximately 36% identity and 46% similarity to the yeast FAH1 gene product, suggesting strong functional conservation despite significant evolutionary distance. Between primates, we would expect much higher sequence identity, likely exceeding 90% between human and Macaca fascicularis FA2H.

Key conserved features across mammalian FA2H proteins include:

  • The N-terminal cytochrome b5 domain critical for electron transfer

  • The iron-binding histidine motif essential for catalytic activity

  • The four transmembrane domains required for proper membrane localization

  • NADPH-binding regions necessary for cofactor interaction

This high degree of conservation reflects the essential role of FA2H in myelin formation and maintenance across mammalian species. Comparative sequence analysis focusing on these functional domains provides valuable insights into structure-function relationships and evolutionary adaptation of this enzyme .

How do experimental approaches differ when working with recombinant FA2H from different species?

Working with recombinant FA2H from different species requires methodological adjustments to accommodate species-specific protein characteristics:

  • Codon optimization: Expression vectors should be optimized for the host system; Macaca fascicularis sequences may require different codon optimization than human sequences for optimal expression

  • Post-translational modifications: Species variations in glycosylation and other modifications may necessitate different expression systems

  • Antibody selection: Epitope differences between species may require specific antibodies for detection and purification

  • Substrate preferences: Subtle differences in substrate specificity may exist between species, requiring broader substrate panels for comprehensive characterization

  • Expression conditions: Temperature, induction timing, and media composition may need adjustment for optimal expression of different species' FA2H

Researchers should validate expression and activity of recombinant Macaca fascicularis FA2H using multiple approaches, including Western blot analysis, enzymatic activity assays, and subcellular localization studies. Cross-species functional complementation experiments, where the Macaca fascicularis gene is expressed in systems lacking endogenous FA2H, provide valuable insights into functional conservation and species-specific properties .

What can comparative analyses of primate FA2H tell us about neurological disease mechanisms?

Comparative analyses of primate FA2H proteins provide unique insights into neurological disease mechanisms:

  • Evolutionary adaptation: Primate-specific adaptations in FA2H may correlate with expanded brain functions and complex myelin structures

  • Disease susceptibility: Species differences in FA2H structure may explain varying susceptibility to neurological disorders across primates

  • Functional domains: Conserved vs. variable regions highlight domains critical for basic function versus those that may modulate species-specific activities

  • Regulatory mechanisms: Differences in expression patterns and regulation may reveal evolutionary adaptations in brain development

  • Therapeutic relevance: Primate-specific features of FA2H may inform the development of targeted therapeutic approaches

By studying Macaca fascicularis FA2H alongside human FA2H, researchers can identify primate-specific mechanisms in myelination and neurological disease. These comparative analyses are particularly valuable for understanding fatty acid hydroxylase-associated neurodegeneration (FAHN) and related disorders where FA2H mutations lead to progressive neurological deterioration. The identification of primate-specific features in FA2H function may reveal new therapeutic targets or explain why certain disease phenotypes are unique to humans .

How can recombinant FA2H be used to screen potential therapeutic compounds for FAHN?

Recombinant Macaca fascicularis FA2H provides an excellent platform for therapeutic compound screening through several methodological approaches:

  • High-throughput activity assays: Develop miniaturized assays measuring 2-hydroxylation activity in the presence of compound libraries

  • Thermal shift assays: Screen for compounds that stabilize mutant FA2H proteins, potentially rescuing function

  • Cell-based phenotypic rescue: Test compounds for their ability to restore 2-hydroxysphingolipid levels in FA2H-deficient cells

  • Structural pharmacology: Use structural information to design compounds that bind specific domains of FA2H

  • Allosteric modulator screening: Identify compounds that enhance the activity of partially functional FA2H mutants

A comprehensive screening approach would include:

  • Primary screening using purified recombinant FA2H in biochemical assays

  • Secondary validation in cellular models expressing Macaca fascicularis FA2H

  • Tertiary testing in animal models of FAHN

The evolutionary proximity of Macaca fascicularis to humans makes this approach particularly valuable for translational research, as compounds effective with the macaque enzyme are more likely to show similar effects with human FA2H. Data from Drosophila and patient-derived fibroblast studies suggest that targeting mitochondrial dynamics and autophagy pathways might provide additional therapeutic avenues .

What role does FA2H play in myelination and remyelination processes?

FA2H plays a critical role in both myelination during development and remyelination following demyelinating injuries:

  • Myelin composition: FA2H generates 2-hydroxysphingolipids that are major components of myelin, particularly galactosylceramides and sulfatides

  • Myelin stability: The 2-hydroxyl groups enable additional hydrogen bonding, enhancing membrane stability and compaction

  • Glial-axonal interactions: 2-hydroxysphingolipids contribute to proper signaling between oligodendrocytes and neurons

  • Remyelination efficiency: FA2H activity is upregulated during remyelination attempts following demyelination

Research on remyelination processes indicates that proper clearance of myelin debris by microglia is essential for effective remyelination. While not directly studied with FA2H, related research with the MERTK gene shows that deficiencies in microglial function impair remyelination following demyelination. This suggests that FA2H function may be particularly important during active myelination and remyelination processes .

The generation of 2-hydroxysphingolipids by FA2H likely contributes to the stability and functional properties of newly formed myelin, making this enzyme a potential therapeutic target for demyelinating disorders beyond FAHN.

How do post-translational modifications affect FA2H function in different neural cell types?

Post-translational modifications (PTMs) of FA2H likely play crucial regulatory roles in modulating enzyme activity across different neural cell types, though specific data on FA2H PTMs is limited in the search results. Based on knowledge of related enzymes, several PTM mechanisms may regulate FA2H:

  • Phosphorylation: May regulate enzymatic activity or subcellular localization in response to signaling pathways

  • Glycosylation: Could affect protein stability and membrane integration

  • Ubiquitination: May control protein turnover rates in different cell types

  • Palmitoylation: Might influence membrane association and localization to specific lipid microdomains

  • Proteolytic processing: Potential regulatory mechanism affecting enzyme activity

Different neural cell types (oligodendrocytes, astrocytes, neurons) likely exhibit distinct patterns of FA2H modification corresponding to cell-specific functions. For example, oligodendrocytes actively engaged in myelination would require highly active FA2H, potentially maintained through specific phosphorylation patterns or reduced ubiquitination.

Future research directions should include comprehensive characterization of FA2H PTMs across neural cell types using mass spectrometry-based proteomic approaches, coupled with functional studies to determine the impact of these modifications on enzymatic activity and cellular localization .

What are common pitfalls in recombinant FA2H expression and how can they be overcome?

Researchers working with recombinant Macaca fascicularis FA2H frequently encounter several experimental challenges:

ChallengeCauseSolution
Low expression levelsToxicity of overexpressed membrane proteinUse inducible expression systems; optimize induction conditions
Inclusion body formationProtein misfoldingLower expression temperature; use solubility tags; optimize codon usage
Lack of enzymatic activityImproper folding or missing cofactorsInclude heme precursors in media; add iron sources; ensure NADPH:P450 reductase co-expression
Proteolytic degradationInstability of recombinant proteinAdd protease inhibitors; use protease-deficient host strains
Aggregation during purificationHydrophobic transmembrane regionsOptimize detergent type and concentration; use glycerol in buffers
Variable glycosylationHeterogeneous post-translational modificationUse insect or mammalian expression systems with controlled glycosylation

When troubleshooting expression issues, a systematic approach is recommended:

  • First verify gene sequence and vector construction

  • Test multiple expression conditions (temperature, induction time, media composition)

  • Evaluate different cell types for expression

  • Consider fusion tags that enhance solubility while maintaining activity

  • Validate protein expression through Western blot before proceeding to activity assays

The N-terminal cytochrome b5 domain is particularly critical for activity, so constructs should be designed to ensure this domain is properly folded and accessible .

How can researchers distinguish between direct and indirect effects in FA2H functional studies?

Distinguishing direct versus indirect effects in FA2H studies requires careful experimental design:

  • Use of domain-specific mutations: Create mutations that affect specific functions (e.g., cytochrome b5 domain) rather than eliminating the entire protein

  • Acute versus chronic manipulations: Compare acute inhibition (e.g., using inhibitors) with chronic deletion (knockout models)

  • Rescue experiments: Test whether reintroducing wild-type FA2H rescues phenotypes in knockout systems

  • Substrate specificity analysis: Determine whether observed effects correlate with changes in specific 2-hydroxysphingolipids

  • Temporal control of gene expression: Use inducible systems to control the timing of FA2H deletion or expression

A particularly powerful approach combines conditional knockout models with rescue experiments using either wild-type or mutant FA2H variants. This strategy can definitively link specific enzymatic functions to observed phenotypes. Research in Drosophila models has demonstrated the validity of rescue experiments, where human FA2H was able to rescue phenotypes in dfa2h-deficient flies, confirming evolutionary conservation of function .

What analytical challenges arise when measuring 2-hydroxysphingolipids in complex biological samples?

Measuring 2-hydroxysphingolipids in biological samples presents several analytical challenges:

  • Structural complexity: 2-hydroxysphingolipids exist in numerous molecular species with varying fatty acid chain lengths and sphingoid bases

  • Low abundance: Some 2-hydroxysphingolipid species may be present at very low concentrations

  • Extraction efficiency: Different extraction methods may preferentially isolate certain lipid classes

  • Matrix effects: Complex biological matrices can interfere with detection and quantification

  • Isomeric compounds: Differentiating between positional isomers (e.g., 2-hydroxy vs. 3-hydroxy fatty acids)

Methodological solutions include:

  • Sample preparation optimization: Develop specialized extraction protocols that maximize recovery of 2-hydroxysphingolipids

  • Internal standards: Use isotopically labeled standards for accurate quantification

  • LC-MS/MS methodology: Employ high-resolution mass spectrometry with appropriate chromatographic separation

  • Multiple reaction monitoring: Target specific transitions for improved sensitivity and selectivity

  • Derivatization strategies: Chemical modification to enhance detection of hydroxyl groups

When analyzing tissues from FA2H-deficient models compared to controls, researchers should expect dramatic reductions in multiple 2-hydroxysphingolipid species, particularly those abundant in myelin such as 2-hydroxy galactosylceramides and sulfatides. Comprehensive lipidomic profiling rather than targeted analysis of a few lipid species provides the most complete assessment of FA2H function .

What emerging technologies could advance our understanding of FA2H function in neurodegenerative processes?

Several cutting-edge technologies hold promise for deeper insights into FA2H function:

  • CRISPR-Cas9 gene editing: Generate precise mutations in endogenous FA2H to study structure-function relationships

  • Single-cell transcriptomics: Analyze cell-type-specific expression patterns and regulatory networks involving FA2H

  • Advanced imaging techniques: Visualize 2-hydroxysphingolipid distribution in myelin using mass spectrometry imaging or click chemistry approaches

  • Organoid models: Develop brain organoids from patient-derived cells to study FA2H function in a complex 3D environment

  • Cryo-EM structural analysis: Determine the atomic structure of FA2H to guide rational drug design

  • Spatially resolved proteomics: Map the FA2H interactome in different subcellular compartments

  • In vivo lipid imaging: Develop probes for tracking 2-hydroxysphingolipids in living systems

Single-cell RNA-sequencing has already provided valuable insights in related research areas, characterizing Mertk-influenced responses to demyelination and remyelination across different cell types. Similar approaches could reveal how FA2H deficiency affects specific neural cell populations and identify compensatory mechanisms .

How might comparative analyses between primate and non-primate FA2H inform therapeutic approaches?

Comparative analyses between primate and non-primate FA2H can guide therapeutic development through several mechanisms:

  • Conserved functional domains: Identify universally essential regions as primary therapeutic targets

  • Primate-specific features: Discover unique regulatory mechanisms that may explain human-specific disease aspects

  • Species-specific interactors: Determine whether FA2H interacts with different proteins across species

  • Differential substrate preferences: Identify subtle differences in substrate specificity that might be therapeutically exploitable

  • Evolutionary adaptations: Understand how FA2H function has been optimized for primate brain development

The Drosophila model of FAHN has already provided valuable insights, revealing connections between FA2H deficiency and mitochondrial dynamics and autophagy. Cross-species rescue experiments demonstrate functional conservation while highlighting species-specific aspects of FA2H biology. These comparative approaches are particularly valuable for understanding why certain therapeutic approaches might succeed in animal models but fail in human trials .

What role might FA2H play in age-related neurological conditions beyond FAHN?

Beyond its established role in FAHN, FA2H may contribute to various age-related neurological conditions:

  • Myelin maintenance during aging: Age-related changes in 2-hydroxysphingolipid composition may affect myelin stability

  • Neuroinflammatory processes: Altered sphingolipid metabolism could influence glial reactivity and neuroinflammation

  • Protein aggregation disorders: Changes in membrane lipid composition might influence protein aggregation in conditions like Alzheimer's and Parkinson's diseases

  • Blood-brain barrier integrity: 2-hydroxysphingolipids may contribute to membrane properties affecting barrier function

  • Mitochondrial function: Based on findings in Drosophila models, FA2H may influence mitochondrial dynamics relevant to age-related neurodegeneration

Research has established connections between sphingolipid metabolism and various neurodegenerative conditions. The finding that FA2H deficiency affects mitochondrial dynamics and autophagy suggests potential interactions with pathways implicated in age-related neurodegeneration. Further investigation of FA2H function in normal aging and age-related neurological disorders represents an important frontier in neurodegeneration research .

What are the key considerations for researchers beginning work with recombinant Macaca fascicularis FA2H?

Researchers initiating studies with recombinant Macaca fascicularis FA2H should consider several critical factors:

  • Expression system selection: Choose mammalian expression systems for functional studies and insect cells for structural work

  • Domain preservation: Ensure constructs maintain intact cytochrome b5 and catalytic domains

  • Activity verification: Implement robust assays measuring 2-hydroxylation activity

  • Comparative analysis: Consider parallel studies with human FA2H to leverage existing knowledge

  • Technical challenges: Anticipate challenges related to membrane protein expression and purification

  • Physiological relevance: Design experiments to address questions relevant to neurological function and disease

Beginning with validated expression constructs (like those available from commercial sources) can accelerate research progress. A systematic characterization approach progressing from basic biochemical characterization to cellular studies and ultimately to in vivo models provides the most comprehensive understanding of FA2H function .

How does current FA2H research contribute to our understanding of neurological disease mechanisms?

Current FA2H research provides significant insights into neurological disease mechanisms through multiple avenues:

  • Myelin biology: Elucidates the role of specific lipid modifications in myelin structure and function

  • Neuron-glia interactions: Reveals how altered glial function affects neuronal health and communication

  • Metabolic regulation: Demonstrates connections between lipid metabolism and neural system homeostasis

  • Progressive neurodegeneration: Illustrates mechanisms of age-dependent deterioration in genetic disorders

  • Mitochondrial dynamics: Establishes links between sphingolipid metabolism and mitochondrial function

  • Therapeutic targets: Identifies potential intervention points for treating demyelinating and neurodegenerative conditions

Studies in both mice and Drosophila models have demonstrated that FA2H deficiency affects multiple cellular pathways, including mitochondrial dynamics, autophagy, neurotransmitter homeostasis, and glial-neuronal interactions. These findings expand our understanding of how specific lipid modifications influence diverse aspects of neural function and how their disruption leads to progressive neurological deterioration .

What methodological advances are needed to accelerate progress in FA2H research?

Several methodological advances would significantly accelerate progress in FA2H research:

  • Improved membrane protein expression systems: Development of expression platforms specifically optimized for membrane-bound enzymes like FA2H

  • High-throughput activity assays: Simplified, scalable methods for measuring FA2H activity suitable for drug screening

  • In vivo imaging of 2-hydroxysphingolipids: Non-invasive methods to track these lipids in living systems

  • Cell-type-specific manipulation tools: Techniques for modulating FA2H activity in specific neural cell populations

  • Structural biology approaches: Methods to determine the three-dimensional structure of membrane-bound FA2H

  • Translational models: Development of primate models that more closely recapitulate human FAHN

  • Biomarker development: Identification of accessible biomarkers reflecting FA2H activity for clinical studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.