Recombinant Macaca fascicularis Fatty acid desaturase 2 (FADS2)

Shipped with Ice Packs
In Stock

Description

Catalytic Mechanism

  • Introduces double bonds at δ6 or δ8 positions in fatty acids, converting linoleic acid (18:2n-6) to γ-linolenic acid (18:3n-6) and α-linolenic acid (18:3n-3) to stearidonic acid (18:4n-3) .

  • Exhibits dual activity: δ6-desaturation is favored over δ8-desaturation by 7–23× depending on substrate .

Biological Roles

  • Maintains membrane fluidity and supports biosynthesis of anti-inflammatory lipid mediators (e.g., resolvins) .

  • Dysregulation linked to Crohn’s disease due to impaired conversion of n-3 fatty acids in mesenteric adipocytes .

  • Overexpression in cancer models promotes tumor proliferation by altering arachidonic acid metabolism .

Disease Modeling

  • Used to study lipid mediator imbalances in Crohn’s disease, where FADS2 restoration reduced pro-inflammatory cytokines by 40–60% in vitro .

  • In cancer studies, correlates with metastasis and chemotherapy resistance (e.g., 2.5× higher expression in metastatic melanoma) .

Biotechnological Development

  • Optimized for LC-PUFA production in aquaculture species, addressing global nutritional shortages .

  • Structural studies aim to engineer variants with enhanced substrate specificity .

Comparative Analysis Across Species

FeatureMacaca fascicularisHumanMouse
Gene IDN/A941556473
Key Substrates18:2n-6, 24:5n-318:2n-6, 20:3n-318:2n-6, 18:3n-3
ThermostabilityStable at 4°C for 7 days Requires -80°C storage Similar to human
Disease AssociationsLimited dataCardiovascular disease Metabolic syndrome

Challenges and Future Directions

  • Production Scalability: Yield varies by host system; E. coli produces 0.5–1.0 mg/L, while HEK293 achieves higher activity but at greater cost .

  • Structural Flexibility: Substrate-binding regions show conformational plasticity, complicating inhibitor design .

  • Therapeutic Potential: Gene therapy trials targeting FADS2 are underway for inflammatory bowel disease .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All protein shipments are by default accompanied by standard blue ice packs. If dry ice shipping is required, please inform us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
FADS2; QtsA-16313; Acyl-CoA 6-desaturase; Delta(6 fatty acid desaturase; D6D; Delta(6 desaturase; Delta-6 desaturase; Fatty acid desaturase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-444
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
Target Protein Sequence
MGKGGNQGEGAAEREVPMPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSTQHPGGQRVI GHYAGEDATDAFRAFHPDLKFVGKFLKPLLIGELAPEEPSQDHGKNSKIIEDFRALKKTA EDMNLFKTNHVFFLLLLAHIIALESIAWFTVFYFGNGWIPTLITAFVLATSQAQAGWLQH DYGHLSVYRKPKWNHLVHKFVIGHLKGASANWWNHRHFQHHAKPNIFHKDPDVNMLHVFV LGEWQPIEYGKKKLKYLPYNHQHEYFFLIGPPLLIPMYFQYQIIMTMIVHKNWVDLAWAI SYYIRFFVTYIPFYGILGALLFLNFIRFLESHWFVWVTQMNHIVMEIDQEAYRDWFSSQL TATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLL RALLDIIRSLRKSGKLWLDAYLHK
Uniprot No.

Target Background

Function
This enzyme plays a crucial role in the biosynthesis of highly unsaturated fatty acids (HUFA) from the essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3) precursors. It acts as a fatty acyl-coenzyme A (CoA) desaturase, introducing a cis double bond at carbon 6 of the fatty acyl chain. This enzyme catalyzes the initial and rate-limiting step in this pathway, converting LA (18:2n-6) and ALA (18:3n-3) into gamma-linoleate (GLA) (18:3n-6) and stearidonate (18:4n-3), respectively. Subsequently, in the biosynthetic pathway of HUFA n-3 series, it desaturates tetracosapentaenoate (24:5n-3) to tetracosahexaenoate (24:6n-3), which is then converted to docosahexaenoate (DHA)(22:6n-3), a vital lipid for nervous system function. Additionally, it can desaturate (11E)-octadecenoate (trans-vaccenoate) at carbon 6, generating (6Z,11E)-octadecadienoate. Beyond Delta-6 activity, this enzyme also exhibits Delta-8 activity with a slight preference for n-3 fatty acyl-CoA substrates.
Database Links

KEGG: mcf:101926688

UniGene: Mfa.12889

Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What enzymatic activities does FADS2 catalyze and what is their relative efficiency?

FADS2 (Fatty acid desaturase 2) primarily functions as a delta-6 desaturase, catalyzing the first and rate-limiting step in long-chain polyunsaturated fatty acid (LCPUFA) biosynthesis. Research has demonstrated that FADS2 also possesses delta-8 desaturase activity, capable of desaturating 11,14-eicosadienoic acid (20:2n-6) and 11,14,17-eicosatrienoic acid (20:3n-3) to yield 20:3n-6 and 20:4n-3, respectively . Competition experiments indicate differential substrate preferences, with delta-8 desaturation favoring 20:3n-3 over 20:2n-6 by approximately 3-fold . When comparing delta-6 versus delta-8 desaturase activities, the delta-6 function is preferentially utilized by 7-fold for n-6 substrates (18:2n-6 vs. 20:2n-6) and 23-fold for n-3 substrates (18:3n-3 vs. 20:3n-3) . This multi-functionality provides alternative biosynthetic routes to physiologically important LCPUFAs from substrates previously considered metabolic dead-ends.

How is the FADS2 gene structured and organized in primates?

The FADS2 gene structure includes multiple exons and introns, with regulatory elements in the promoter region that control tissue-specific expression. Gene structure studies conducted during knockout model generation revealed that approximately 1 kb of the promoter region, exon 1, and part of intron 1 are critical for functional expression . The FADS gene family in primates, including Macaca species and humans, typically consists of FADS1, FADS2, and FADS3 clustered on a single chromosome (chromosome 11 in humans) . In some mammalian species, a fourth FADS-like gene has been identified, though its functional significance remains under investigation . This genomic organization is evolutionarily significant, as it differs from the arrangement seen in other vertebrate lineages.

What are the metabolic consequences of FADS2 activity in vivo?

FADS2 activity is essential for generating physiologically important fatty acid products, including the immediate precursors of bioactive eicosanoids. The 20:3n-6 produced via FADS2 activity serves as the immediate precursor for prostaglandin E1 and thromboxane B1 . Additionally, 20:3n-6 and 20:4n-3 are direct precursors to arachidonic acid and eicosapentaenoic acid, respectively—critical signaling molecules involved in inflammation, immune function, and membrane integrity . Knockout studies in mice have demonstrated that FADS2 disruption impairs reproduction and prevents in vivo synthesis of arachidonic acid, highlighting the enzyme's essential role in normal physiological functioning . These findings underscore the importance of FADS2 in maintaining lipid homeostasis across various tissues and biological processes.

What expression systems yield functional recombinant Macaca fascicularis FADS2?

For functional characterization of desaturases, Saccharomyces cerevisiae has proven to be an effective heterologous expression system. Studies have successfully used yeast transformed with FADS2 constructs from various species to characterize enzymatic activities . When expressing recombinant Macaca fascicularis FADS2, researchers should construct expression vectors containing the complete coding sequence derived from mRNA, preferably isolated from liver tissue which typically shows high FADS2 expression. The use of appropriate promoters (such as GAL1 in yeast systems) and codon optimization may enhance expression levels. Verification of successful transformation and expression requires both molecular techniques (PCR, western blotting) and functional assays to confirm enzymatic activity. Compared to bacterial systems, yeast offers the advantage of appropriate post-translational modifications and cellular machinery for membrane protein expression.

How can researchers differentiate between endogenous desaturase activity and recombinant FADS2 activity in expression systems?

To distinguish recombinant FADS2 activity from endogenous desaturase functions, researchers should employ careful experimental design with appropriate controls. Using Saccharomyces cerevisiae is advantageous since it lacks endogenous delta-6 and delta-8 desaturase activities . When using other expression systems, researchers should:

  • Include empty vector controls subjected to identical culture conditions and substrates

  • Design the recombinant protein with epitope tags that enable specific immunoprecipitation

  • Utilize FADS2-specific inhibitors (such as SC26196) as negative controls to validate activity source

  • Conduct detailed quantitative analysis of substrate conversion ratios across multiple experimental conditions

  • Perform comparative analyses with recombinant human FADS2 to identify species-specific activity profiles

When analyzing fatty acid profiles via GC-MS, researchers should establish baseline conversion rates in control systems to accurately attribute desaturation products to the recombinant enzyme activity.

What is the recommended protocol for measuring FADS2 desaturase activity in vitro?

The gold standard for FADS2 activity characterization involves heterologous expression followed by substrate conversion analysis. A comprehensive protocol includes:

  • Transform yeast with the FADS2 expression construct derived from Macaca fascicularis

  • Culture transformed yeast in appropriate media supplemented with potential fatty acid substrates (e.g., 18:3n-3, 18:2n-6, 20:4n-3, 20:3n-6, 22:5n-3, 22:4n-6)

  • Extract total lipids from cultured cells using chloroform/methanol extraction

  • Derivatize fatty acids to methyl esters for GC-MS analysis

  • Identify and quantify both substrate and product fatty acid methyl esters

  • Calculate conversion rates as percentage of substrate converted to desaturated product

This approach has successfully characterized FADS proteins across multiple species and allows for direct comparison of substrate preferences and enzymatic efficiency . The protocol can detect both delta-6 and delta-8 desaturase activities by providing appropriate substrate panels. Analysis should include statistical evaluation of replicate experiments to establish confidence intervals for enzyme activity measurements.

How do substrate concentration and reaction conditions affect FADS2 kinetics?

When characterizing FADS2 kinetics, researchers must optimize several parameters that significantly impact enzyme performance. FADS2 shows differential activity depending on substrate concentration, with potential substrate inhibition at higher concentrations. Competition experiments reveal that substrate preference ratios can vary considerably—delta-8 desaturation favors 20:3n-3 over 20:2n-6 by 3-fold, while delta-6 desaturase activity is preferred over delta-8 activity by 7-fold for n-6 substrates and 23-fold for n-3 substrates .

Optimal reaction conditions include:

  • pH range: 6.5-7.5

  • Temperature: 28-30°C for yeast expression systems

  • Cofactors: NADH, NADPH, cytochrome b5

  • Oxygen availability: critical for desaturase function

  • Membrane integrity: essential for proper enzyme orientation and function

Researchers should establish Michaelis-Menten parameters (Km and Vmax) for each substrate to fully characterize the enzyme's catalytic properties and substrate preferences. Time-course experiments further elucidate the progression of desaturation reactions under varying conditions.

How does Macaca fascicularis FADS2 activity compare with homologs from other species?

Comprehensive comparison of FADS2 activity across species reveals significant evolutionary adaptations in substrate specificity and catalytic efficiency. While specific data on Macaca fascicularis FADS2 must be experimentally determined, research on other species provides a framework for investigation. In catshark (Scyliorhinus canicula), FADS2 demonstrates exclusive delta-6 desaturase activity with high conversion rates: 73% for 18:3n-3 and 57% for 18:2n-6 . This contrasts with teleost fish, where FADS2 exhibits both delta-5 and delta-6 activities—a functional adaptation believed to compensate for the absence of a discrete FADS1 gene .

The following comparative data from functional characterization of various species can guide expectations for Macaca fascicularis studies:

SpeciesPrimary FADS2 ActivitiesNotable Characteristics
HumanDelta-6, Delta-8High specificity for n-3 substrates
MouseDelta-6, Delta-8Essential for reproduction
CatsharkDelta-6 onlyNo delta-5 activity detected
Teleost fishDelta-6, Delta-5Adapted for marine environment

When characterizing Macaca fascicularis FADS2, researchers should conduct side-by-side comparisons with human FADS2 under identical conditions to identify primate-specific patterns of activity that may inform translational research applications.

What can FADS2 gene knockouts in model organisms reveal about Macaca fascicularis FADS2 function?

Knockout models provide critical insights into FADS2 physiological functions that cannot be obtained through in vitro studies alone. FADS2 gene disruption in mice has demonstrated that no in vivo arachidonic acid synthesis occurs in knockout animals, confirming FADS2's essential role in LCPUFA biosynthesis . These knockout mice exhibited impaired male reproduction, suggesting critical roles for FADS2-derived fatty acids in fertility .

When analyzing FADS2 function across species:

  • Generate tissue-specific expression profiles using qPCR or RNA-seq to identify conservation patterns

  • Compare knockdown/knockout phenotypes across model organisms

  • Perform rescue experiments with recombinant Macaca fascicularis FADS2 in knockout models

  • Analyze compensatory mechanisms that may emerge in knockout systems

  • Evaluate the impact on downstream metabolites and physiological processes

These comparative approaches can reveal evolutionarily conserved functions versus species-specific adaptations, providing context for understanding primate-specific aspects of FADS2 biology relevant to biomedical research.

How can researchers identify and characterize alternative FADS2 splice variants in Macaca fascicularis?

Alternative splicing generates functionally diverse FADS2 isoforms with tissue-specific expression patterns. To comprehensively characterize these variants in Macaca fascicularis:

  • Perform 5' and 3' rapid amplification of cDNA ends (RACE) using gene-specific primers to identify all possible transcript variants

  • Conduct RT-PCR with primers spanning potential splice junctions to confirm variant existence

  • Use RNA-seq data analysis to quantify isoform expression levels across different tissues

  • Clone and express individual splice variants to assess their functional differences

  • Develop isoform-specific antibodies for protein-level detection and subcellular localization studies

Research on primate FADS genes has identified multiple alternatively spliced variants that are conserved across species and show reciprocal changes in expression during cell differentiation . These variants may result from alternative transcription initiation, alternative selection of poly(A) sites, and internal exon deletions . Each variant potentially contributes unique regulatory or functional properties to fatty acid metabolism in different cellular contexts.

What is the relationship between FADS gene family members and how do they interact functionally?

The FADS gene family constitutes an integrated enzymatic system with complex regulatory relationships. Recent research has identified a novel FADS1 isoform that potentiates FADS2-mediated production of fatty acids, suggesting functional interactions between gene family members . When investigating these relationships:

  • Perform co-expression analyses of FADS family members across tissues and developmental stages

  • Conduct co-immunoprecipitation experiments to identify physical interactions between proteins

  • Utilize CRISPR-Cas9 to modulate expression of individual FADS genes while monitoring others

  • Examine compensatory changes in expression following genetic or pharmacological inhibition

  • Investigate shared transcriptional regulatory mechanisms across the gene family

Understanding these interactions is critical when interpreting the physiological impact of manipulating FADS2 activity, as other family members may compensate for or modulate its functions in vivo. The genomic organization of FADS genes in clusters suggests co-evolution and potential coordinated regulation that should be considered in experimental design and data interpretation.

How does FADS2 inhibition affect cancer cell phenotypes, and what are the implications for therapeutic development?

FADS2 inhibition significantly impacts cancer cell behavior, particularly in melanoma models where it suppresses cell migration and metastasis. Research demonstrates that FADS2 expression is significantly upregulated in metastatic melanoma compared to primary melanoma . Inhibition through either pharmacological means (SC26196) or genetic knockdown (shRNA) reduces cell migration by 1.5-2 fold . Most significantly, FADS2 knockdown resulted in a 68% reduction in lung metastases in mouse models, highlighting its potential as a therapeutic target .

The mechanism appears to involve FADS2-derived sapienate, which modulates membrane fluidity—a critical factor in cell migration and metastasis . Researchers investigating FADS2 in disease models should:

  • Evaluate expression levels across cancer stages and correlate with clinical outcomes

  • Compare efficacy of different FADS2 inhibitors using standardized migration and invasion assays

  • Analyze changes in membrane composition and fluidity following inhibition

  • Investigate combination approaches with existing cancer therapies

  • Develop tissue-specific targeting strategies to minimize systemic effects on essential fatty acid metabolism

These approaches can help determine whether recombinant Macaca fascicularis FADS2 offers advantages as a model system for human cancer therapeutics development.

What methodological considerations are important when studying FADS2 in cellular membrane organization?

FADS2 demonstrates significant localization to the plasma membrane, indicating direct involvement in membrane lipid composition and fluidity regulation . When investigating these aspects:

  • Employ subcellular fractionation techniques to confirm enzyme localization

  • Utilize fluorescent membrane fluidity probes to quantify changes following FADS2 modulation

  • Perform lipidomic analysis of membrane fractions to identify specific fatty acid incorporation patterns

  • Conduct lateral mobility measurements using fluorescence recovery after photobleaching (FRAP)

  • Investigate membrane microdomain (lipid raft) composition and organization

Research shows that LD-rich melanoma cells exhibit higher membrane fluidity than LD-poor cells, and this fluidity is significantly reduced when fatty acid uptake is suppressed . Importantly, supplementation with sapienate (a FADS2 product) restores membrane fluidity, suggesting a direct causal relationship . These findings have broad implications for understanding how FADS2 activity influences cellular behavior beyond its classical role in fatty acid biosynthesis.

How can researchers reconcile contradictory data on FADS2 substrate specificity across experimental systems?

Contradictory findings regarding FADS2 substrate specificity may arise from multiple methodological factors. To systematically address these discrepancies:

  • Standardize substrate concentrations and presentation methods (free fatty acids vs. CoA derivatives)

  • Account for differences in membrane composition between expression systems

  • Evaluate cofactor availability and stoichiometry in different experimental setups

  • Consider post-translational modifications that may differ between recombinant and native systems

  • Examine potential protein-protein interactions that might modulate activity in vivo but be absent in simplified systems

Competition experiments provide valuable insights, revealing that substrate preference ratios can vary significantly—delta-8 desaturation favors 20:3n-3 over 20:2n-6 by 3-fold, while delta-6 activity is preferred over delta-8 activity by 7-fold for n-6 and 23-fold for n-3 substrates . These complex relationships make direct comparisons between studies challenging without standardized methodologies. Researchers should implement systematic substrate panels tested under identical conditions to generate comparable datasets.

What emerging technologies will advance our understanding of FADS2 structure-function relationships?

Several cutting-edge approaches show promise for deepening our understanding of FADS2 biology:

  • Cryo-electron microscopy for high-resolution structural determination of membrane-associated FADS2

  • Single-molecule enzymology to characterize kinetic heterogeneity in FADS2 activity

  • Genome-wide CRISPR screens to identify novel regulators and interaction partners

  • Metabolic flux analysis using stable isotope labeling to track FADS2-dependent pathways in vivo

  • Organ-on-chip technologies incorporating tissue-specific FADS2 expression patterns

Additionally, comparative genomics approaches that leverage the growing number of sequenced primate genomes can identify conserved regulatory elements and functional domains specific to primates. Computational modeling of substrate binding and catalysis, validated through site-directed mutagenesis, will further elucidate the molecular basis for the enzyme's diverse catalytic activities and substrate preferences. These advanced approaches will address fundamental questions about how structural differences between Macaca fascicularis FADS2 and homologs from other species translate to functional adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.