Recombinant Macaca fascicularis G-protein coupled receptor 1 (GPR1)

Shipped with Ice Packs
In Stock

Description

Overview of G-protein Coupled Receptors in Non-human Primates

G-protein coupled receptors (GPCRs) constitute a large and diverse family of transmembrane proteins that play crucial roles in cellular signaling processes across mammalian species. These receptors are characterized by their seven-transmembrane domain structure and their ability to transduce extracellular signals through interaction with intracellular G-proteins. In non-human primates, including Macaca fascicularis, GPCRs represent the single largest class of drug targets, with significant implications for pharmacogenetic effects that are modulated in part by naturally occurring polymorphisms .

Recent large-scale polymorphism discovery studies have revealed substantial variation in GPCR genes across macaque populations. Research examining Indian-origin rhesus macaques (Macaca mulatta), Chinese-origin rhesus macaques, and cynomolgus macaques (Macaca fascicularis) has identified nearly 25,000 single nucleotide polymorphisms (SNPs) in GPCR coding sequences, including over 14,000 non-synonymous and more than 9,500 synonymous protein-coding SNPs . These polymorphisms show specific distribution patterns across receptor domains, with particular concentration in regions critical to receptor function.

Evolutionary Conservation and Divergence

The evolutionary relationships between human and macaque GPCRs demonstrate significant conservation of structure and function, making macaque models particularly valuable for biomedical research. Polymorphism and divergence studies have revealed that variation is highly concentrated in N-terminal and C-terminal domains and the third intracellular loop region of GPCRs across macaque populations . These regions are critical to ligand-binding and signaling, suggesting functional significance to the observed variations.

Genetic Characteristics

Based on patterns observed in other Macaca fascicularis GPCRs, GPR1 is likely encoded by a protein-coding gene with specific regulatory elements controlling its tissue-specific expression. While the exact gene ID for Macaca fascicularis GPR1 is not specified in the available research data, the pattern of genetic organization would be expected to follow that of other GPCRs in this species, as demonstrated in studies of MRGPRX1 (MAS related GPR family member X1), another GPCR from the same species .

Recombinant Production and Characterization

The production of recombinant Macaca fascicularis GPR1 follows established protocols for membrane protein expression, though specific optimizations may be required for this particular receptor.

Expression Systems and Methodologies

Recombinant production of Macaca fascicularis proteins has been successfully demonstrated using various expression systems. For example, recombinant production of Macaca fascicularis IgG receptor FcRn has been achieved using E. coli expression systems with N-terminal 6xHis-SUMO-tagged constructs . Similar approaches might be applied to GPR1 production, though membrane proteins typically require additional considerations for proper folding and function.

Purification and Characterization Techniques

Purification of recombinant macaque proteins typically employs affinity chromatography approaches, with purity assessments conducted via SDS-PAGE. For the IgG receptor FcRn from Macaca fascicularis, purification protocols have achieved greater than 90% purity as determined by SDS-PAGE . Similar high-standard purification protocols would be essential for functional studies of recombinant GPR1.

Functional Role and Signaling Pathways

While specific information on GPR1 signaling in Macaca fascicularis is limited, the receptor likely participates in similar signaling pathways as other GPCRs in this species.

Signaling Cascade Interactions

GPCRs in Macaca fascicularis interact with multiple signaling pathways, including the Rap1 signaling pathway which controls diverse processes such as cell adhesion, cell-cell junction formation, and cell polarity . Like other G proteins, Rap1 cycles between inactive GDP-bound and active GTP-bound conformations, with this cycle controlled by extracellular signals through regulation of guanine nucleotide exchange factors and GTPase activating proteins .

Physiological Significance

The physiological roles of GPR1 in Macaca fascicularis may include immune system modulation, neurological function, and metabolic regulation, though specific functions require further investigation. Related GPCRs in macaques have demonstrated expression in neural tissues, suggesting potential roles in neurological processes .

Research Applications and Significance

Recombinant Macaca fascicularis GPR1 offers significant value for comparative primate studies, drug development, and disease modeling.

Comparative Primate Pharmacology

Non-human primate models focused on naturally-occurring, functionally-parallel polymorphisms in candidate genes have been developed to better understand GPCR function and pharmacology . These models provide critical insights into receptor-ligand interactions that may be translatable to human medicine.

Neurological Research Applications

GPCRs expressed in neural tissues of Macaca fascicularis have been utilized for studying various neurological processes and pathologies. For example, brain progenitor cells isolated from embryonic brain of cynomolgus monkeys have been characterized by neurosphere assay and utilized for cell culture studies . Similar approaches could potentially employ GPR1 for specific neurological investigations.

Polymorphism and Variation Analysis

The study of genetic variation in GPCRs across macaque populations provides valuable insights into receptor evolution and potential functional differences.

Natural Variation Patterns

Large-scale polymorphism studies in macaque GPCRs have revealed that regions showing the least evolutionary constraint display greater rates of polymorphism and higher frequencies of polymorphic variants . While the majority of identified SNPs are singletons, approximately 1,750 non-synonymous and 2,900 synonymous SNPs have been found in multiple individuals, suggesting potential functional significance .

Comparative Table of GPCR Polymorphism Distribution in Macaques

RegionPolymorphism DensityFunctional Significance
N-terminal domainHighLigand recognition and binding
Transmembrane domainsLow to moderateStructural stability and signal transduction
Intracellular loopsVariable (high in ICL3)G-protein coupling and downstream signaling
C-terminal domainHighRegulatory functions and receptor trafficking

This distribution pattern has been observed across multiple GPCR family members in macaques and likely applies to GPR1 as well .

Future Research Directions

The study of recombinant Macaca fascicularis GPR1 presents several promising avenues for future investigation.

Therapeutic Target Potential

As GPCRs represent the largest class of drug targets, detailed characterization of Macaca fascicularis GPR1 could reveal novel therapeutic opportunities. The development of specific ligands and modulators for this receptor may have applications in various disease contexts.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CMKLR2; GPR1; Chemerin-like receptor 2; Chemerin chemokine-like receptor 2; Chemokine-like receptor 2; G-protein coupled receptor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-355
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
Target Protein Sequence
MEDLEETLFEEFENYSYALDYYSLESDLEEKVQLGVVHWVSLVLYCLSFVLGIPGNAIVI WFTGFKWKRTVSTLWFLNLAIADFIFLLFLPLYISYVVMNFHWPFGIWLCKANSFTAQLN MFASVFFLTVISLDHYIHLIHPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRDTVE FNNHTLCYNNFQKHDPDLTVIRHHVLTWVKYIVGYLFPLLTMSICYLCLILKVKKRSILI SSRHFWTILAVVVAFVVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFLNSCLN PILYVLISKKFQARFRSSVAEILKYTLWEVSCSGTVSEQLRNSETKNLCLLETAQ
Uniprot No.

Target Background

Function
This receptor for the chemoattractant adipokine chemerin/RARRES2 suggests a role in regulating inflammation and energy homeostasis. Signaling primarily occurs via the beta-arrestin pathway. RARRES2 binding weakly activates G proteins, calcium mobilization, and MAPK1/MAPK3 (ERK1/2) phosphorylation. It also acts as a receptor for TAFA1, mediating its effects on neuronal stem-cell proliferation and differentiation through the activation of ROCK/ERK and ROCK/STAT3 signaling pathways.
Database Links

KEGG: mcf:102126131

UniGene: Mfa.6054

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is GPR1 and what is its biological significance in Macaca fascicularis?

GPR1 (G-protein coupled receptor 1) is a seven-transmembrane domain receptor belonging to the G-protein coupled receptor superfamily. In Macaca fascicularis, GPR1 functions as a chemokine receptor involved in cell signaling pathways. Research indicates that GPR1 is expressed in various tissues including brain progenitor cells, suggesting its role in neural development and function. The receptor has been identified as being expressed in brain progenitor cells isolated from embryonic brain of cynomolgus monkeys (Macaca fascicularis) alongside other receptors such as CD4, CXCR4, CCR5, STRL33, and APJ . This expression pattern suggests GPR1 may participate in complex signaling networks within the developing and mature brain.

How can researchers distinguish between GPR1 and other closely related G-protein coupled receptors in experimental systems?

Distinguishing GPR1 from other closely related receptors requires a multi-faceted approach:

  • Sequence-based identification: Use primers specific to the GPR1 sequence (such as the one identified in the product database: full-length protein spanning region 1-355) .

  • Antibody specificity: Employ antibodies that target unique epitopes of GPR1 not shared with other GPCRs.

  • Functional assays: Utilize ligand binding specificity and downstream signaling patterns that are unique to GPR1.

  • Expression pattern analysis: Compare tissue distribution profiles, as GPR1 has a characteristic expression pattern in neural tissues of Macaca fascicularis.

When conducting RT-PCR or immunohistochemistry, researchers should always include appropriate controls to verify specificity, particularly when studying tissues known to express multiple GPCR types.

What are the known expression patterns of GPR1 in different tissues of Macaca fascicularis?

Based on current research findings, GPR1 expression in Macaca fascicularis has been documented in:

  • Brain progenitor cells (BPCs): Expression confirmed through RT-PCR analysis in both undifferentiated and differentiated BPCs isolated from embryonic brain .

  • Neural tissues: Expression detected in cells derived from brain progenitor cells that have been induced to differentiate.

The expression of GPR1 alongside other receptors such as CD4, CXCR4, and CCR5 in brain cells suggests potential roles in neuroimmune interactions and possibly viral neurotropism . More comprehensive tissue expression profiling would require additional research beyond what is currently available in the literature.

What are the optimal conditions for working with recombinant Macaca fascicularis GPR1 in vitro?

When working with recombinant Macaca fascicularis GPR1, researchers should consider the following methodological aspects:

Storage and Handling:

  • Store recombinant protein at -20°C or -80°C for extended storage

  • Avoid repeated freeze-thaw cycles; prepare working aliquots stored at 4°C for up to one week

  • Use Tris-based buffer with 50% glycerol as optimal storage medium

Expression Systems:

  • Mammalian expression systems (such as HEK293 or CHO cells) typically yield properly folded GPCRs with appropriate post-translational modifications

  • Consider using inducible expression systems to control expression levels

  • For membrane preparation, use buffers containing protease inhibitors to prevent degradation

Functional Assays:

  • Maintain physiological pH (7.2-7.4) and temperature (37°C) during binding and signaling assays

  • Include appropriate positive controls (known ligands) and negative controls in all assays

  • Consider the impact of tags (His, FLAG, etc.) on receptor functionality; C-terminal tags are generally less disruptive to GPCR function than N-terminal modifications

How can researchers validate the functionality of recombinant Macaca fascicularis GPR1 after expression?

Validating GPR1 functionality requires multiple approaches:

  • Ligand Binding Assays:

    • Radioligand binding using known ligands if available

    • Competition binding assays to determine binding affinities

    • Saturation binding to determine receptor density

  • Signaling Assays:

    • cAMP accumulation or inhibition (depending on G-protein coupling)

    • Calcium mobilization assays using fluorescent indicators

    • β-arrestin recruitment assays

    • ERK phosphorylation measurements

  • Receptor Trafficking Studies:

    • Surface expression quantification using flow cytometry

    • Internalization assays using fluorescently-labeled antibodies or ligands

    • Recycling studies to assess receptor dynamics

  • Structural Validation:

    • Western blotting to confirm expression of full-length protein (46.4 kDa for similar GPCRs)

    • Glycosylation analysis to verify post-translational modifications

    • Circular dichroism or other spectroscopic methods to assess proper folding

A comprehensive validation should include at least one assay from each category to ensure both expression and functionality of the recombinant GPR1.

What considerations should be made when designing GPR1 knockout or overexpression experiments in Macaca fascicularis cells?

When designing genetic manipulation experiments for GPR1 in Macaca fascicularis cells:

For Knockout Approaches:

  • Consider CRISPR/Cas9 targeting of conserved regions within the GPR1 coding sequence

  • Design multiple guide RNAs to increase efficiency

  • Validate knockout using both genomic sequencing and protein expression analysis

  • Include off-target analysis, particularly for related GPCR family members

  • Establish appropriate control cell lines (non-targeting gRNA)

For Overexpression Studies:

  • Select appropriate promoters (constitutive vs. inducible)

  • Consider codon optimization for Macaca fascicularis cells

  • Include epitope tags that don't interfere with receptor function

  • Quantify expression levels and compare to endogenous expression

  • Control for potential artifacts from overexpression (mislocalization, constitutive activity)

Functional Validation:

  • Compare wild-type, knockout, and rescue phenotypes

  • Assess both basal and stimulated signaling

  • Examine potential compensatory mechanisms (upregulation of related GPCRs)

  • Analyze downstream signaling pathways and biological outcomes

  • Consider single-cell analysis to account for heterogeneity in expression

How does viral infection affect GPR1 expression and function in Macaca fascicularis neural cells?

Research using brain progenitor cells (BPCs) from Macaca fascicularis has demonstrated connections between viral infection and GPR1 expression:

  • Expression in Susceptible Cells: GPR1 is expressed alongside other receptors (CD4, CXCR4, CCR5) in brain progenitor cells that are susceptible to SIV infection, suggesting potential roles in viral neurotropism .

  • Infection Dynamics: When studying viral effects on GPR1:

    • Establish baseline GPR1 expression before infection

    • Monitor expression changes at multiple time points post-infection

    • Compare effects across different viral strains (e.g., neurotropic vs. non-neurotropic)

    • Examine cell-type specific responses in heterogeneous neural cultures

  • Methodological Approaches:

    • Use quantitative RT-PCR to measure changes in GPR1 mRNA levels

    • Perform immunocytochemistry to examine receptor localization changes

    • Employ signaling assays to determine functional alterations

    • Implement receptor trafficking studies to assess internalization patterns

  • Research Significance: Understanding how viral infection modulates GPR1 might provide insights into mechanisms of viral neuropathogenesis. The BPC-derived cell culture system offers a valuable model for studying these interactions in a controlled environment free from confounding factors like macrophages/microglial cells .

What role might GPR1 play in neural development based on its expression in Macaca fascicularis brain progenitor cells?

The detection of GPR1 in brain progenitor cells suggests potential roles in neural development:

  • Developmental Expression Pattern:

    • GPR1 is expressed in both undifferentiated and differentiated brain progenitor cells from embryonic Macaca fascicularis brain

    • This suggests potential functions in both proliferative progenitors and their differentiated progeny

  • Research Approaches:

    • Temporal expression analysis during different developmental stages

    • Co-localization studies with developmental markers (nestin, GFAP, Tuj1)

    • Function-blocking experiments using antibodies or knockdown approaches

    • Ligand identification in developing neural tissues

  • Potential Developmental Functions:

    • Migration regulation of neural progenitors

    • Differentiation fate determination

    • Axon guidance and synaptogenesis

    • Establishment of neural circuits

  • Experimental Design Considerations:

    • Use developmentally staged tissues or time-course differentiation protocols

    • Compare expression between proliferative zones and areas of differentiation

    • Consider species differences when translating findings to human development

    • Employ 3D culture systems to better recapitulate in vivo development

How can comparative studies between Macaca fascicularis GPR1 and human GPR1 inform translational research?

Comparative studies between species provide valuable insights for translational applications:

  • Sequence and Structural Comparison:

    • Align complete protein sequences to identify conserved functional domains

    • Focus on key regions: ligand binding pocket, G-protein coupling domains, phosphorylation sites

    • Model structural differences that might affect drug binding and signaling

  • Functional Comparison:

    • Parallel signaling assays using identical experimental conditions

    • Comparative pharmacological profiling with panel of compounds

    • Evaluation of species-specific regulatory mechanisms

  • Experimental Design Framework:

    • Express both receptors in identical cellular backgrounds

    • Use domain swapping to identify regions responsible for functional differences

    • Develop assays sensitive enough to detect subtle pharmacological differences

  • Translational Relevance:

    • Data tables comparing key parameters between species:

ParameterMacaca fascicularis GPR1Human GPR1Significance
Sequence homologyReference sequence available Compare % identityPredicts functional conservation
Tissue distributionExpressed in brain progenitors Compare human expressionGuides relevant model systems
Ligand specificityTo be determinedHuman ligand profilePredicts drug response translation
Signaling pathwaysTo be determinedHuman signaling profileInforms pathway conservation

This comparative approach helps researchers determine how findings in Macaca fascicularis models might translate to human applications, particularly for drug development targeting GPR1.

How can researchers resolve inconsistent results in GPR1 signaling assays?

When facing inconsistent results in GPR1 signaling experiments, consider these methodological approaches:

  • Receptor Expression Variability:

    • Quantify receptor expression levels between experiments

    • Implement stable cell lines with controlled expression

    • Consider using inducible systems to standardize expression

  • Assay Optimization:

    • Standardize cell density, passage number, and culture conditions

    • Optimize ligand concentrations and exposure times

    • Control for receptor desensitization in repeated stimulation protocols

  • Technical Considerations:

    • Validate antibody specificity through multiple approaches

    • Prepare consistent membrane fractions for binding assays

    • Use internal standards in each experiment

  • Systematic Troubleshooting Approach:

IssuePossible CauseSolution
Variable response magnitudeInconsistent receptor expressionQuantify receptor levels by flow cytometry or Western blot before each experiment
Loss of response over timeReceptor degradationOptimize storage conditions (-20°C to -80°C); avoid freeze-thaw cycles
High background signalNon-specific bindingIncrease washing steps; optimize blocking conditions
Poor reproducibilityProtocol variationsStandardize all reagents and create detailed SOPs
Failed positive controlsProtein denaturationVerify protein quality before experiments
  • Data Analysis Approaches:

    • Normalize data to positive controls run in parallel

    • Apply appropriate statistical tests for comparing treatments

    • Consider Bayesian analysis for integrating results across experiments

    • Implement quality control thresholds for inclusion of experimental replicates

What statistical methods are most appropriate for analyzing GPR1 functional data?

  • Dose-Response Analysis:

    • Nonlinear regression for calculating EC50/IC50 values

    • Four-parameter logistic model for full curves

    • Consider variable slope models when appropriate

    • Bootstrap methods for confidence interval estimation

  • Receptor Binding Studies:

    • Scatchard analysis or nonlinear regression for Kd determination

    • Statistical comparison of binding parameters across conditions

    • Multiple comparison corrections for screening studies

  • Time-Course Experiments:

    • Repeated measures ANOVA for comparing treatments over time

    • Area under the curve (AUC) analysis for response quantification

    • Mixed-effects models for handling missing data points

  • Comparison Across Experimental Conditions:

    • ANOVA with appropriate post-hoc tests for multiple comparisons

    • Non-parametric alternatives when normality assumptions are violated

    • Consider power analysis to determine adequate sample sizes

  • Advanced Analytical Approaches:

    • Principal component analysis for complex signaling datasets

    • Cluster analysis for identifying response patterns

    • Machine learning approaches for predicting ligand activities

    • Pathway analysis for contextualizing GPR1 signaling within broader networks

When publishing GPR1 research findings, clearly describe all statistical methods, include appropriate visualizations, and report both statistical significance and effect sizes to facilitate interpretation and reproducibility.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.