Recombinant Macaca fascicularis Gap junction alpha-1 protein (GJA1)

Shipped with Ice Packs
In Stock

Description

Production and Expression Systems

This recombinant protein is synthesized using multiple expression platforms to meet diverse experimental needs:

Expression SystemApplications
Mammalian CellsEnsures proper folding and post-translational modifications (e.g., phosphorylation) .
E. coliCost-effective for large-scale production but lacks mammalian glycosylation patterns .
Insect CellsBalances yield and post-translational accuracy .

For example, Creative BioMart offers a His-tagged variant expressed in mammalian cells (HEK293), optimized for functional assays .

Gap Junction Dynamics

GJA1 forms hexameric connexon channels, enabling intercellular transport of ions (e.g., Ca²⁺, K⁺) and metabolites (e.g., cAMP) . In Macaca fascicularis, recombinant GJA1 has been used to:

  • Study cardiac synchronization defects linked to arrhythmias .

  • Model bladder dysfunction by regulating intercellular communication in smooth muscle .

Ciliogenesis and Trafficking

Recent studies in human and Xenopus models reveal GJA1’s role in ciliary assembly via Rab11 interaction:

  • Rab11 Association: GJA1 colocalizes with Rab11-positive vesicles at the basal body, facilitating CP110 removal from centrioles to initiate ciliogenesis .

  • Mitochondrial Regulation: An alternative isoform, GJA1-20k, enhances mitochondrial biogenesis and reduces oxidative stress during cardiac ischemia .

Research Applications

ApplicationExperimental Use
Cardiac ResearchInvestigating arrhythmias and heart malformations via gap junction inhibition .
Ciliary DisordersModeling ciliopathies using in vitro systems (e.g., retinal pigment epithelium cells) .
Drug ScreeningTesting compounds targeting intercellular communication in cancer or metabolic diseases .

Key Challenges and Future Directions

  • Species-Specific Variants: Functional differences between primate and rodent GJA1 necessitate careful model selection .

  • Isoform Complexity: Roles of truncated isoforms (e.g., GJA1-20k) in stress responses require further exploration .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will strive to accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of that tag.
Synonyms
GJA1; QflA-10385; Gap junction alpha-1 protein; Connexin-43; Cx43
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-382
Protein Length
Full Length of Mature Protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
Target Protein Sequence
GDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGC ENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDGV NVEMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSIFEVAFLLIQWYIYGFSL SAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRVK GKSDPYHATSGALSPTKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKPVTGDRNNSSCRNY NKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQ RPSSRASSRASSRPRPDDLEI
Uniprot No.

Target Background

Function
Gap junction protein that acts as a regulator of bladder capacity. A gap junction comprises a cluster of closely packed pairs of transmembrane channels, called connexons, through which low molecular weight materials diffuse from one cell to a neighboring cell. It may play a critical role in the physiology of hearing by participating in the recycling of potassium to the cochlear endolymph. This protein acts as a negative regulator of bladder functional capacity by enhancing intercellular electrical and chemical transmission, thus sensitizing bladder muscles to cholinergic neural stimuli and causing them to contract. It may contribute to cell growth inhibition by regulating NOV expression and localization. It plays an essential role in gap junction communication within the ventricles.
Database Links

KEGG: mcf:101867099

UniGene: Mfa.8739

Protein Families
Connexin family, Alpha-type (group II) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction. Endoplasmic reticulum.

Q&A

What isoforms of GJA1 exist and what are their functional significances?

Multiple isoforms of GJA1 have been identified, with the GJA1-20k isoform being particularly significant in research:

IsoformSizeOriginPrimary FunctionResearch Significance
GJA1-43k43 kDaFull-length translationForms primary gap junction channelsMain functional protein in intercellular communication
GJA1-20k20 kDaInternally translated C-terminusRegulates actin cytoskeleton and full-length Cx43 traffickingKey regulator of gap junction assembly
Other smaller isoformsVariousInternal translation or proteolytic cleavageRegulatory functionsLess characterized but potentially important in cellular signaling

The GJA1-20k isoform is generated through internal translation of the GJA1 mRNA and contains the C-terminal cytoplasmic tail of full-length Cx43 . This isoform has been shown to aid in Cx43 gap junction localization by stabilizing actin filaments, which in turn organizes microtubule-directed trajectories for Cx43 transport to the cell-cell border .

How do storage conditions affect recombinant Macaca fascicularis GJA1 stability and activity?

For optimal stability of recombinant Macaca fascicularis GJA1 protein:

  • Short-term storage: Store at 4°C (refrigerated) for up to one week

  • Extended storage: Store at -20°C, with sensitive preparations at -80°C

  • Storage buffer: Tris-based buffer with 50% glycerol is optimal for maintaining protein stability

  • Freeze-thaw cycles: Repeated freezing and thawing is not recommended as it leads to significant protein degradation

  • Working aliquots: Prepare small aliquots for experimental use to avoid repeated freeze-thaw cycles

Stability studies have demonstrated that under appropriate storage conditions, the loss rate is less than 5% within the expiration date . Recombinant GJA1 typically maintains thermal stability when incubated at 37°C for 48 hours without obvious degradation or precipitation .

What experimental approaches can be used to study GJA1-20k's role in actin stabilization and Cx43 trafficking?

GJA1-20k plays a critical role in regulating actin dynamics and subsequently Cx43 trafficking. The following methodological approaches have proven effective:

A. Micropatterned cell pairing systems:

  • Create defined cell-cell interfaces using micropatterned coverslips

  • Transfect cells with GJA1-20k expression vectors (e.g., pDEST-GJA1-20k-GFP)

  • Visualize actin organization using phalloidin staining

  • This approach has revealed that GJA1-20k stabilizes filamentous actin without affecting actin protein expression

B. Latrunculin A challenge assay:

  • Treat cells with low-dose latrunculin A (LatA, 250 nM) to disrupt actin polymerization

  • Compare actin filament stability between control and GJA1-20k expressing cells

  • GJA1-20k has been shown to protect actin filaments from LatA disruption, preserving microtubule trajectory to cell-cell borders

C. Co-immunoprecipitation studies:

  • Use HA-tagged GJA1-20k for pull-down experiments

  • Cell lysis buffer composition: 150 mM KCl, 20 mM HEPES (pH7.4), 2 mM MgCl₂, 2 mM K₂HPO₄, 1 mM DTT, 25 μM phalloidin, with protease/phosphatase inhibitors and 0.5% NP40

  • This technique has confirmed that GJA1-20k complexes with both actin and tubulin

D. In vivo gene transfer:

  • Use AAV9-mediated gene delivery of GJA1-20k to animal models

  • Assess Cx43 localization at intercalated discs via immunofluorescence

  • Quantify Cx43 gap junction plaque size

  • This approach demonstrated that GJA1-20k markedly increases endogenous Cx43 gap junction plaque size at intercalated discs

How can researchers effectively visualize GJA1 trafficking and localization in primate cell models?

Several advanced imaging techniques can be employed to study GJA1 trafficking and localization:

A. Fluorescently-tagged protein imaging:

  • Generate GFP- or V5-tagged GJA1 constructs for transfection

  • Use time-lapse confocal microscopy to track protein movement

  • For Macaca fascicularis GJA1, ensure tagging doesn't interfere with trafficking by comparing with immunostaining of endogenous protein

B. Immunofluorescence visualization of endogenous protein:

  • Fix cells with 4% PFA (20 minutes at room temperature) or 100% ice-cold methanol (5 minutes at -20°C)

  • Block and permeabilize with 10% normal goat serum and 0.5% TritonX-100 in PBS

  • Use primary antibodies specifically validated for Macaca fascicularis GJA1

  • Visualize with Alexa fluor secondary antibodies

C. EB1 comet assay for microtubule dynamics:

  • Label cell-cell borders using N-Cadherin or WGA

  • Visualize EB1 comets to track microtubule growth trajectories

  • Quantify the number of EB1 comets reaching the cell-cell border normalized to border length

  • This technique has shown that GJA1-20k helps maintain microtubule trajectories toward cell-cell borders

D. Electron microscopy for ultrastructural analysis:

  • Fix cells in 2% glutaraldehyde, post-fix with 1% osmium tetroxide

  • Process through ethanol dehydration and embed in resin

  • Section using ultramicrotome and mount on EM grids

  • This approach provides detailed visualization of gap junction structure and membrane integration

What roles do microRNAs play in regulating GJA1 expression and how can this be experimentally investigated?

MicroRNAs are significant post-transcriptional regulators of GJA1 expression, particularly in pathological conditions:

A. miR-19b regulation of GJA1:

  • miR-19b directly targets GJA1 by binding to its 3'-UTR

  • This interaction has been confirmed using luciferase reporter assays with wild-type and mutant 3'-UTR binding sites

  • The binding site sequence in GJA1 3'-UTR is conserved across species including human, rat, dog, and mouse

  • In viral myocarditis, miR-19b is significantly upregulated and leads to downregulation of GJA1

Experimental approach for studying miRNA regulation:

  • miRNA mimics and inhibitor studies:

    • Transfect cells with miR-19b mimics or inhibitors

    • Assess GJA1 protein levels by Western blot

    • Studies have shown that GJA1 protein levels are negatively correlated with miR-19b expression

  • Luciferase reporter assays:

    • Construct reporters containing wild-type or mutant GJA1 3'-UTR

    • Co-transfect with miRNA mimics or inhibitors

    • miR-19b has been shown to decrease GJA1-3'-UTR-wt fluorescence intensity but not affect GJA1-3'-UTR-mut constructs

  • Functional rescue experiments:

    • Overexpress GJA1 to counteract miRNA effects

    • In cardiomyocyte models, GJA1 overexpression rescues the irregular beating patterns caused by miR-19b

  • Cooperative miRNA studies:

    • Test multiple miRNAs that target GJA1

    • miR-19b has been shown to cooperate with miR-1 to inhibit GJA1 expression in a dose-dependent manner

What methods can be used to optimize expression and purification of recombinant Macaca fascicularis GJA1?

Successful expression and purification of recombinant Macaca fascicularis GJA1 requires careful optimization:

A. Expression systems:

  • Mammalian cell expression: Provides proper post-translational modifications and folding

    • HEK293 cells are commonly used for cynomolgus GJA1 expression

    • Yields authentic protein structure but typically lower yields

  • E. coli expression: Suitable for partial domains (especially the C-terminal region)

    • Higher yields but lacks post-translational modifications

    • Used successfully for mouse GJA1 fragments

B. Purification strategies:

  • For His-tagged recombinant GJA1:

    • Lyse cells in buffer containing 20mM Tris, 150mM NaCl, pH8.0, with 1mM EDTA, 1mM DTT, detergent, and protease inhibitors

    • Purify using nickel-affinity chromatography

    • Consider size exclusion chromatography as a polishing step

    • Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) without vortexing to avoid protein denaturation

C. Quality control assessment:

  • Purity verification: SDS-PAGE and Western blot (>97% purity achievable)

  • Endotoxin testing: LAL method (<1.0EU per μg protein)

  • Functional validation: Gap junction formation assay or dye transfer assay

How can Macaca fascicularis GJA1 be utilized in gene therapy research with nonhuman primate models?

Macaca fascicularis GJA1 is particularly valuable for translational research in gene therapy applications:

A. Gene delivery strategies:

  • Adeno-associated virus (AAV) vectors:

    • AAV9 serotype shows efficient cardiac tropism for GJA1 delivery

    • Recombinant AAV9 carrying GJA1-20k has been shown to increase endogenous Cx43 gap junction plaque size at intercalated discs

    • Typical dose: 3 × 10¹⁰ vector genomes (vg) for in vivo studies

  • Adenoviral vectors:

    • First-generation recombinant adenovirus can be used for liver-directed gene transfer

    • Requires immunosuppression for repeated administrations

    • Protocol for immunosuppression: Rituximab (anti-CD20 monoclonal antibody) for B-cell depletion plus FK506 for T-cell inhibition

B. Therapeutic applications under investigation:

  • Cardiac protection:

    • GJA1-20k gene delivery protects Cx43 localization to intercalated discs against acute ischemic injury

    • Helps maintain cell-cell coupling in instances of anticipated myocardial ischemia

  • Monitoring gene expression:

    • Reporter genes like HSV1-tk can be used alongside GJA1 for in vivo visualization

    • PET imaging with [¹⁸F]-FHBG allows for semi-quantitative assessment of transgene expression

C. Challenges and considerations:

  • Immune responses: Neutralizing antibodies to viral vectors can prevent repeated administrations

  • Transient cytokine responses: Peaks of IL-6, TNF-α, and IL-1β occur within 24 hours after vector administration

  • Safety monitoring: Regular assessment of liver enzymes (ALT, AST) and blood cell counts is recommended

What is known about the nuclear function of GJA1 and its role as a transcriptional regulator?

Beyond its canonical role in gap junctions, GJA1/Cx43 can also function as a transcriptional regulator:

A. Nuclear localization mechanism:

  • The carboxy tail of Cx43 can translocate to the nucleus

  • This translocation requires interaction with the basic transcription factor-3 (BTF3)

  • Once in the nucleus, Cx43 fragments form a complex with RNA Polymerase II

B. Transcriptional targets:

  • Cx43 directly regulates N-cadherin transcription

  • The Cx43/PolII complex binds directly to the N-cadherin promoter

  • This mechanism is conserved between amphibian and mammalian cells

C. Experimental approaches to study nuclear GJA1:

  • Subcellular fractionation:

    • Separate nuclear, cytoplasmic, and membrane fractions

    • Western blot analysis to detect GJA1 fragments in nuclear extracts

  • Chromatin immunoprecipitation (ChIP):

    • Use antibodies against Cx43 C-terminus

    • Identify DNA binding sites genome-wide

    • Analyze enrichment at specific promoters (e.g., N-cadherin)

  • Reporter gene assays:

    • Construct reporter plasmids containing promoters of interest

    • Co-transfect with Cx43 expression vectors

    • Measure transcriptional activity

This nuclear function of Cx43/GJA1 represents an emerging area of research that expands our understanding beyond its classical role in gap junctional communication .

What are the most effective methods for studying GJA1 conformational changes in Macaca fascicularis models?

Studying conformational changes in GJA1/Cx43 requires specialized techniques:

A. Cryo-electron microscopy (cryo-EM):

  • Preparation: Purify GJA1 in detergents or reconstitute in lipid nanodiscs

  • Analysis: This technique has revealed three different N-terminal helix conformations in Cx43:

    • Gate-covering (GCN)

    • Pore-lining (PLN)

    • Flexible intermediate (FIN)

  • The conformational equilibrium shifts to GCN in the presence of cholesteryl hemisuccinates and to PLN by C-terminal truncations and varying pH

B. Site-directed mutagenesis:

  • Create strategic mutations at key residues in the N-terminus and transmembrane domains

  • Assess channel function using dye transfer assays or electrophysiology

  • This approach has identified an α-to-π-helix transition in the first transmembrane helix, creating a side opening to the membrane in FIN and PLN conformations

C. Molecular dynamics simulations:

  • Construct models based on cryo-EM structures

  • Simulate behavior in membrane environments

  • Identify conformational transitions and energy landscapes

D. Antibodies recognizing specific conformations:

  • Generate conformation-specific antibodies

  • Use for immunofluorescence or immunoprecipitation

  • Particularly useful for studying the distribution of different conformational states in tissues

Understanding these conformational changes is essential for developing interventions targeting specific functional states of GJA1 in disease conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.