Recombinant Macaca fascicularis Gap junction beta-1 protein (GJB1)

Shipped with Ice Packs
In Stock

Description

Production Systems

This recombinant protein is commercially available through platforms like Creative BioMart, which employs multiple expression systems for optimization :

Expression SystemTagPurityApplication
Mammalian cells (HEK293)FLAG, His, or GST>90% (SDS-PAGE)Cell-cell communication studies
E. coliAvi-tag>85%Structural analysis, antibody production
Wheat germNative>80%ELISA, immunogen development

Research Applications

Recombinant Macaca fascicularis GJB1 is utilized in:

ApplicationExperimental ModelKey Findings
Gap junction traffickingHeLa cell transfectionMutants form ER-retained aggregates
Protein-protein interactionCo-IP assaysBinds calnexin (ER chaperone)
Drug screeningHigh-throughput assaysIdentified connexin modulators

Comparative Analysis of Mutant Phenotypes

Studies on human GJB1 mutants reveal mechanisms potentially applicable to Macaca fascicularis variants :

MutationCellular EffectPathological Outcome
F31SIncreased SDS-soluble multimersImpaired Schwann cell signaling
W44GER aggregation, stress granule formationReduced cell viability
R220Pfs*23Truncated C-terminal domainCentral nervous system deficits

Unresolved Research Questions

  1. Does Macaca fascicularis GJB1 exhibit species-specific trafficking mechanisms compared to human homologs?

  2. What role do post-translational modifications play in its channel gating?

  3. Can this recombinant protein model CMTX1 pathology in non-human primates?

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize development according to your specification.
Synonyms
GJB1; QorA-11550; Gap junction beta-1 protein; Connexin-32; Cx32
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
GJB1
Target Protein Sequence
MNWTGLYTLLSGVNRHSTAIGRVWLSVIFIFRIMVLVVAAESVWGDEKSSFICNTLQPGC NSVCYDQFFPISHVRLWSLQLILVSTPALLVAMHVAHQQHIEKKMLRLEGHGDPLHLEEV KRHKVHISGTLWWAYVISVVFRLLFEAVFMYVFYLLYPGYAMVRLVKCDVYPCPNTVDCF VSRPTEKTVFTVFMLAASGICIILNVAEVVYLIIRACARRAQRRSNPPSRKGSGFGHRLS PEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC
Uniprot No.

Target Background

Function
A gap junction is composed of a cluster of closely packed pairs of transmembrane channels, known as connexons, through which low molecular weight materials can diffuse between neighboring cells.
Database Links

UniGene: Mfa.8204

Protein Families
Connexin family, Beta-type (group I) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is Gap Junction Beta-1 protein and what cellular functions does it serve?

Gap junction beta-1 protein (GJB1), also known as connexin 32 (Cx32), is a transmembrane protein that assembles to form gap junction channels between adjacent cells. These channels facilitate the transfer of ions and small molecules between cells, enabling intercellular communication. In the nervous system, GJB1 is primarily expressed in Schwann cells in the peripheral nervous system and oligodendrocytes in the central nervous system. In Schwann cells specifically, GJB1 forms channels that facilitate transfers between layers of the myelin . This protein plays a critical role in maintaining myelin integrity and proper nerve signal transmission. Mutations in human GJB1 are associated with X-linked Charcot-Marie-Tooth disease (CMTX1), characterized by peripheral nerve demyelination and delayed nerve conduction .

How does Macaca fascicularis GJB1 compare structurally with human GJB1?

While the search results don't provide specific comparative data between human and Macaca fascicularis GJB1, research approaches would include sequence alignment analysis, structural modeling, and functional domain comparison. The human GJB1 protein contains four transmembrane domains with intracellular N- and C-terminal regions . Researchers investigating Macaca fascicularis GJB1 would typically perform bioinformatic analyses to determine sequence homology percentages, conserved functional domains, and species-specific variations that might affect protein folding or channel assembly. This comparative approach helps identify evolutionarily conserved regions that are likely critical for function versus regions that may have species-specific adaptations.

What expression systems are optimal for producing functional recombinant Macaca fascicularis GJB1?

Based on approaches used for human GJB1 research, mammalian expression systems would be preferred for recombinant Macaca fascicularis GJB1 production. HeLa cells have been successfully used to express human GJB1, as demonstrated in mutation studies . For recombinant Macaca GJB1, researchers should consider:

  • Mammalian cell lines (HEK293, CHO, or COS-7 cells) to maintain proper post-translational modifications

  • Vector selection with strong promoters (CMV promoter has been effective for GJB1 expression)

  • Addition of epitope tags (such as FLAG tag) for detection and purification without compromising function

  • Inducible expression systems to control expression levels and minimize potential toxicity

  • Co-expression with chaperone proteins if aggregation issues are encountered

The expression construct design should incorporate proper signal sequences and membrane-targeting motifs to ensure correct localization of this transmembrane protein.

What purification challenges are specific to Macaca fascicularis GJB1 and how can they be addressed?

Purification of recombinant GJB1 presents several challenges due to its transmembrane nature. Based on research approaches with human GJB1, researchers should consider:

  • Membrane protein solubilization:

    • Use of appropriate detergents (mild non-ionic detergents like DDM or CHAPS)

    • Sequential extraction methods to separate different protein fractions

    • Avoid harsh detergents that might disrupt protein structure

  • Aggregation prevention:

    • Temperature control during extraction and purification

    • Addition of stabilizing agents

    • Optimization of salt concentrations and pH

  • Purification strategy:

    • Affinity chromatography using epitope tags (His-tag or FLAG-tag)

    • Size exclusion chromatography to separate monomers from multimers

    • Ion exchange chromatography as a polishing step

Researchers should monitor for the formation of higher molecular weight multimers and aggregates throughout the purification process, as GJB1 has shown a tendency to form these species even under normal conditions .

What methodologies are most effective for assessing gap junction channel functionality of recombinant Macaca fascicularis GJB1?

To assess the functionality of recombinant Macaca fascicularis GJB1 gap junction channels, researchers should employ multiple complementary approaches:

  • Dye transfer assays:

    • Using fluorescent tracers like Lucifer Yellow or calcein-AM

    • Microinjection or scrape-loading techniques

    • Fluorescence recovery after photobleaching (FRAP)

  • Electrophysiological measurements:

    • Dual whole-cell patch-clamp recordings

    • Measurement of junctional conductance between coupled cells

    • Assessment of voltage-gating properties

  • Imaging approaches:

    • Immunofluorescence microscopy to confirm proper localization to gap junction plaques at cell-cell interfaces

    • Co-staining with cellular compartment markers (Calnexin for ER, GM130 for Golgi)

    • Live cell imaging with fluorescently tagged GJB1 to monitor trafficking

  • Biochemical characterization:

    • Immunoblotting to detect formation of hexameric connexons

    • Native gel electrophoresis to preserve multimeric structures

    • Chemical crosslinking to stabilize channel complexes

These approaches should be performed in cell systems expressing the recombinant protein to evaluate its ability to form functional channels and compare with wild-type human GJB1.

How can researchers distinguish between hemichannel and gap junction channel activities when studying recombinant GJB1?

Distinguishing between hemichannel and complete gap junction channel activities requires specific experimental designs:

  • Hemichannel activity assessment:

    • Low calcium conditions to promote hemichannel opening

    • Dye uptake assays using membrane-impermeable dyes (e.g., ethidium bromide)

    • Whole-cell patch clamp of single cells to measure hemichannel currents

    • Use of hemichannel blockers (e.g., lanthanum, carbenoxolone)

  • Gap junction channel assessment:

    • Cell pairing experiments with one cell population expressing GJB1 and another expressing a compatible connexin

    • Dual patch-clamp recordings between cell pairs

    • Metabolic coupling assays measuring transfer of metabolites

  • Comparative analysis:

    • Side-by-side comparison of hemichannel vs. gap junction activities under various conditions

    • Dose-response relationships to channel blockers

    • Mutational analysis of domains involved in docking vs. pore formation

This differentiation is crucial as hemichannels and complete gap junction channels may have distinct physiological roles and pharmacological properties.

How do specific mutations in GJB1 affect protein folding, trafficking, and channel function?

GJB1 mutations can significantly impact protein behavior at multiple levels. Based on studies of human GJB1 mutations:

  • Protein folding effects:

    • Mutations in transmembrane domains (like F31S and W44G) can alter protein folding and stability

    • Frameshift mutations (like R220Pfs*23) can cause truncated proteins with severe structural aberrations

    • Structural alterations can lead to protein aggregation within the cell

  • Trafficking impacts:

    • Mutant GJB1 may accumulate in the endoplasmic reticulum rather than trafficking to the plasma membrane

    • Different mutations show varying degrees of colocalization with ER markers like Calnexin

    • Some mutations may still reach the membrane but fail to form proper gap junction plaques

  • Channel function:

    • Mutations can affect permeability and selectivity of the channel

    • Voltage gating properties may be altered

    • Regulatory responses to pH or calcium may be compromised

  • Cellular consequences:

    • Formation of stress granules (detected by G3BP1 marker)

    • Reduced cell viability

    • Possible induction of unfolded protein response

For Macaca fascicularis GJB1 research, similar analytical approaches would be valuable to understand structure-function relationships across species.

What computational methods can be used to predict the functional impact of GJB1 variants in Macaca fascicularis compared to humans?

Computational approaches provide valuable insights for predicting functional impacts of GJB1 variants:

  • Sequence-based methods:

    • Multiple sequence alignment across species to identify conserved regions

    • Conservation scoring algorithms (ConSurf, SIFT, PolyPhen-2)

    • Evolutionary trace analysis to identify functionally important residues

  • Structural modeling:

    • Homology modeling based on available connexin structures

    • Molecular dynamics simulations to assess stability changes

    • Protein-protein docking to evaluate hemichannel and gap junction formation

    • Energy minimization to predict the impact of mutations on protein folding

  • Machine learning approaches:

    • Training on known human GJB1 pathogenic variants

    • Feature extraction from sequence, structure, and evolutionary data

    • Classification of variants as likely benign or pathogenic

  • Comparative analysis:

    • Mapping of known human pathogenic variants onto Macaca fascicularis GJB1

    • Identification of species-specific constraints or tolerances

    • Prediction of compensatory mechanisms that might exist in non-human primates

These computational predictions should guide experimental design and help prioritize variants for functional characterization.

What experimental controls are essential when comparing recombinant Macaca fascicularis GJB1 with human GJB1?

Rigorous experimental design for cross-species GJB1 comparisons requires several critical controls:

  • Expression level standardization:

    • Quantitative western blotting to ensure comparable protein levels

    • Inducible expression systems with titrated induction

    • Internal control proteins for normalization

  • Cellular context controls:

    • Expression in the same cell line under identical conditions

    • Comparison in multiple cell types relevant to GJB1 function

    • Co-expression with species-matched interacting proteins

  • Technical controls:

    • Tagged and untagged versions to assess tag interference

    • Multiple detection antibodies to eliminate epitope bias

    • Parallel assays performed simultaneously with identical reagents

  • Functional assessment controls:

    • Wild-type positive controls from both species

    • Known non-functional mutants as negative controls

    • Dose-response curves for pharmacological agents

  • Data analysis considerations:

    • Blinded analysis to prevent bias

    • Statistical approaches accounting for biological variability

    • Normalization methods appropriate for cross-species comparisons

These controls help distinguish true species differences from technical artifacts or expression-level effects.

How can interspecies variation in GJB1 inform our understanding of channel evolution and species-specific adaptations?

Interspecies comparison of GJB1 provides insights into evolutionary constraints and adaptations:

  • Evolutionary rate analysis:

    • Calculation of dN/dS ratios to identify regions under purifying selection

    • Identification of positively selected sites that may confer species-specific advantages

    • Comparison with other connexin family members to identify GJB1-specific evolutionary patterns

  • Structure-function correlation:

    • Mapping interspecies variations onto structural models

    • Identifying species differences in functional domains vs. non-functional regions

    • Correlation of amino acid differences with electrophysiological properties

  • Functional divergence assessment:

    • Measurement of species-specific differences in channel properties

    • Evaluation of regulatory responses to physiological stimuli

    • Assessment of compatibility between connexins from different species

  • Context-dependent analysis:

    • Correlation of GJB1 sequence variations with species-specific myelination patterns

    • Analysis of co-evolution with interacting proteins

    • Consideration of species differences in expression patterns and tissue distribution

These evolutionary insights can help distinguish essential functional elements from adaptable regions, guiding rational protein engineering efforts.

What mechanisms underlie GJB1 protein aggregation and how can this inform therapeutic approaches for CMTX1?

GJB1 aggregation mechanisms revealed through research have significant implications:

  • Aggregation triggers and characteristics:

    • Mutations in transmembrane domains promote aggregation

    • Frameshift mutations show distinct aggregation patterns compared to missense mutations

    • Higher levels of SDS-resistant GJB1 multimers observed in mutant forms

    • Aggregates primarily accumulate in the endoplasmic reticulum

  • Cellular consequences:

    • Formation of stress granules (detected by G3BP1 marker)

    • Impaired gap junction plaque formation

    • Reduced cell viability correlating with aggregate formation

    • Different mutations show varying cytotoxicity levels

  • Potential therapeutic approaches:

    • Chaperone-based therapies to improve protein folding

    • Proteasome modulators to enhance clearance of misfolded proteins

    • Autophagy inducers to clear protein aggregates

    • Chemical chaperones that might stabilize correctly folded protein

  • Experimental models:

    • Cell-based assays with fluorescently tagged GJB1 for high-throughput screening

    • Transgenic animal models expressing mutant GJB1

    • Patient-derived cells for validation studies

Understanding these mechanisms in Macaca fascicularis GJB1 could provide additional insights due to subtle species differences in protein processing machinery.

How does post-translational modification of GJB1 differ between Macaca fascicularis and humans, and what are the functional implications?

Post-translational modifications (PTMs) can significantly influence GJB1 function:

  • Analytical approaches:

    • Mass spectrometry-based proteomics to map PTM sites

    • Site-directed mutagenesis of potential modification sites

    • Antibodies specific to modified forms

    • Treatment with inhibitors of specific modifications

  • Key PTMs to investigate:

    • Phosphorylation sites that regulate channel gating

    • Ubiquitination affecting protein turnover

    • Glycosylation influencing trafficking

    • S-nitrosylation affecting channel permeability

  • Experimental designs:

    • Expression in cells from both species to preserve species-specific modification machinery

    • Pharmacological manipulation of PTM-regulating enzymes

    • Creation of phosphomimetic and phospho-null mutants

    • Temporal analysis of modifications during protein maturation

  • Functional correlation:

    • Patch-clamp studies of channels with modified or unmodified GJB1

    • Trafficking studies correlating PTMs with subcellular localization

    • Half-life determinations to assess stability differences

    • Assessment of protein-protein interactions dependent on modifications

This information could explain species differences in GJB1 function and inform the development of therapeutic approaches targeting specific modifications.

What strategies can overcome expression and solubility challenges when working with recombinant Macaca fascicularis GJB1?

Addressing expression and solubility challenges requires systematic optimization:

  • Expression construct optimization:

    • Codon optimization for expression system

    • Testing different signal sequences

    • Fusion partners that enhance solubility (MBP, SUMO, thioredoxin)

    • Inducible promoters to control expression levels

  • Host cell optimization:

    • Screening multiple cell lines (HEK293, CHO, insect cells)

    • Co-expression with chaperones or folding modulators

    • Growth at reduced temperatures to slow folding

    • Supplementation with chemical chaperones (glycerol, trimethylamine N-oxide)

  • Solubilization approaches:

    • Detergent screening (systematic testing of multiple detergent classes)

    • Detergent mixtures to enhance extraction efficiency

    • Lipid nanodiscs or amphipols for membrane protein stabilization

    • Cell-free expression systems with direct incorporation into liposomes

  • Purification strategy adaptation:

    • Mild purification conditions to prevent aggregation

    • On-column folding approaches

    • Addition of stabilizing ligands during purification

    • Size exclusion chromatography to separate aggregates

When encountering specific issues like those observed with human GJB1 mutations (such as formation of multimers and aggregates) , targeted modifications to these approaches will be necessary.

How can researchers distinguish between native oligomerization and pathological aggregation of recombinant GJB1?

Differentiating between functional oligomers and pathological aggregates is crucial:

  • Biochemical characterization:

    • Native PAGE vs. SDS-PAGE with and without heat denaturation

    • Size exclusion chromatography to separate species by size

    • Analytical ultracentrifugation to determine stoichiometry

    • Sequential extraction with detergents of increasing strength

  • Structural analysis:

    • Negative-stain electron microscopy to visualize oligomers vs. aggregates

    • Mass photometry for single-molecule mass determination

    • Cross-linking coupled with mass spectrometry to identify interfaces

    • Dynamic light scattering to assess size distribution

  • Functional correlations:

    • Correlation between oligomeric state and channel activity

    • Impact of conditions favoring different states on function

    • Mutational analysis of interfaces involved in oligomerization

  • Cellular assays:

    • Co-localization with markers for functional gap junctions vs. aggregation

    • FRAP (Fluorescence Recovery After Photobleaching) to assess mobility

    • Correlation with stress granule formation or cell viability

    • Proteasomal and autophagic degradation susceptibility

Based on human GJB1 research, wild-type protein can form some level of aggregates, but mutations significantly increase aggregation propensity , suggesting a continuum rather than a binary division between native oligomers and pathological aggregates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.