Recombinant Macaca fascicularis Gap junction delta-4 protein (GJD4)

Shipped with Ice Packs
In Stock

Description

Molecular Overview

GJD4, also known as Connexin-40.1 (Cx40.1), is a transmembrane protein that forms gap junctions – intercellular channels facilitating direct cytoplasmic exchange of ions and small molecules . The recombinant variant for Macaca fascicularis (cynomolgus monkey) is engineered for experimental applications.

PropertyDetails
UniProt IDQ9N0B3
Gene NameGJD4 (ORF: QccE-15512)
Protein LengthFull-length (1-370 amino acids)
Expression SystemEscherichia coli (E. coli) with N-terminal His tag
Purity>90% (verified by SDS-PAGE)
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose; avoid repeated freeze-thaw cycles

Role in Gap Junction Assembly

  • GJD4 forms hexameric hemichannels that dock with counterparts on adjacent cells to create conduits for molecular exchange .

  • In zebrafish, ortholog gjd4 (Cx46.8) mediates bioelectric coordination in slow muscle cells, critical for embryonic development .

Pathophysiological Relevance

  • While GJD4 itself is not directly linked to cardiac disease, related connexins like GJB4 (Cx30.3) are implicated in hypertrophic cardiomyopathy .

  • Connexin dysregulation (e.g., altered Cx40/Cx43 ratios) is associated with arrhythmias and hypertrophy .

Experimental Use Cases

  • Mechanistic Studies: Used to investigate connexin trafficking and gap junction dynamics .

  • Disease Modeling: Enables comparative studies of connexin dysfunction in primates .

Technical Advantages

  • High Stability: Lyophilized form retains activity after reconstitution in glycerol-containing buffers .

  • Species Specificity: Provides a non-human primate model for translational research .

Key Considerations

  • Limitations: Recombinant GJD4 lacks post-translational modifications (e.g., phosphorylation) present in mammalian systems .

  • Ethical Compliance: Labeled "Not For Human Consumption" due to regulatory restrictions .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please indicate them in your order. We will prepare the product according to your specifications.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
GJD4; QccE-15512; Gap junction delta-4 protein; Connexin-40.1; Cx40.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-370
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
GJD4
Target Protein Sequence
MEGVDLLGFLIITLNCNVTMXGKLWFVLTMLLRMLVIVLAGRPVYQDEQERFVCNTLQPG CANVCYDVFSPVSHLRFWLIQGVCVLLPSAVFSVYVLHRGATLAALGPRRCPEPRDTASG QRRCPGSCRERGGLEVPDFSAGYIIHLLLRTLLEAAFGALNYLLFGFLAPNKFPCTRPPC TGVVDCYVSRPTEKSLLMLFLWAVSALSFLLGLADLVCSLRRLMRRRPGPPTSPSIRKQS GAPGHPEGRPTDKEGGREQEGAPAPPVARAGGEGAGSPRVTSRVSGHTKIPDEDASEVTS SASEKLGRQPRGRPYREAAQDPRGSGSEEQPSAAPSHLAAHPSCSRLQPPDPPASSVGAP HLRARKSEWV
Uniprot No.

Target Background

Function
Gap junctions are comprised of clusters of closely packed pairs of transmembrane channels, known as connexons. These channels facilitate the diffusion of low molecular weight materials between neighboring cells.
Database Links

KEGG: mcf:102131448

UniGene: Mfa.6432

Protein Families
Connexin family, Delta-type subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What are the functional domains of GJD4 protein and their respective roles in gap junction formation?

GJD4, like other connexin proteins, contains four transmembrane domains that anchor the protein in the cell membrane, two extracellular loops that facilitate the docking of hemichannels between adjacent cells, and cytoplasmic N- and C-terminal domains that regulate channel gating and protein interactions .

Each gap junction channel is formed by the docking of two hemichannels (connexons), with each hemichannel composed of six connexin subunits . The extracellular loops contain highly conserved cysteine residues that form disulfide bonds critical for proper hemichannel docking and channel function. The C-terminal domain contains regulatory sites for post-translational modifications that influence channel gating properties and protein turnover.

What expression systems are most effective for producing recombinant Macaca fascicularis GJD4 protein?

E. coli expression systems have been successfully used to produce recombinant Macaca fascicularis GJD4 protein with N-terminal His tags . For optimal protein production, the following methodology is recommended:

  • Clone the full-length GJD4 gene (encoding amino acids 1-370) into an appropriate expression vector containing an N-terminal His tag

  • Transform into an E. coli expression strain optimized for membrane protein expression

  • Induce protein expression under controlled temperature conditions (typically 18-25°C) to enhance proper folding

  • Lyse cells under non-denaturing conditions using appropriate detergents to solubilize membrane proteins

  • Purify using immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography

When higher eukaryotic post-translational modifications are required, mammalian expression systems like HEK293 or CHO cells may be preferable, though yields are typically lower than with prokaryotic systems.

What are the optimal storage conditions for maintaining recombinant GJD4 protein stability and functionality?

For optimal stability of recombinant GJD4 protein, the following storage conditions are recommended:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • After reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL, add glycerol to a final concentration of 5-50% (optimally 50%)

  • Aliquot to avoid repeated freeze-thaw cycles

  • For short-term use, store working aliquots at 4°C for up to one week

  • For long-term storage, keep at -20°C/-80°C

Repeated freeze-thaw cycles should be strictly avoided as they can lead to protein denaturation and loss of functional activity. When using the protein for functional studies, it's advisable to thoroughly validate each new batch for activity before conducting critical experiments.

How can GJD4 from Macaca fascicularis be used as a model to study human gap junction-related diseases?

Macaca fascicularis GJD4 shares high sequence homology with human GJD4, making it an excellent model for studying human gap junction-related diseases . Researchers can design experiments that leverage this homology in several ways:

  • Comparative functional studies: Parallel expression of human and macaque GJD4 in cell lines to evaluate differences in channel properties, regulation, and protein interactions

  • Disease modeling: Introduction of disease-associated mutations identified in human GJD4 into the macaque ortholog to evaluate functional consequences

  • Drug screening: Using macaque GJD4 to screen compounds that modulate gap junction function as potential therapeutic agents for human diseases

  • In vivo studies: Evaluation of gap junction function in macaque tissues as a preclinical model for human disease therapies

The similar genomic organization and high sequence similarity between human and macaque GJD4 (>90%) provides strong translational relevance for research findings . This makes studies in Macaca fascicularis particularly valuable for understanding human gap junction biology in both normal and pathological states.

What methodologies are effective for studying GJD4 protein interactions with other connexins in heteromeric and heterotypic gap junctions?

To study GJD4 interactions with other connexins in heteromeric and heterotypic gap junctions, researchers can employ the following methodologies:

  • Co-immunoprecipitation (Co-IP): Using specific antibodies against GJD4 to pull down protein complexes, followed by western blotting to identify interacting connexins

  • Förster Resonance Energy Transfer (FRET): Tagging GJD4 and potential partner connexins with appropriate fluorophores to detect protein-protein interactions in live cells

  • Bimolecular Fluorescence Complementation (BiFC): Fusing GJD4 and partner connexins with complementary fragments of fluorescent proteins to visualize interactions

  • Dual whole-cell patch clamp: Measuring electrical conductance in cell pairs expressing different combinations of connexins to characterize heterotypic channel properties

  • Dye transfer assays: Using gap junction-permeable dyes to assess functional communication between cells expressing GJD4 and other connexins

When designing these experiments, it's important to consider that connexins can form both homomeric (same connexin) and heteromeric (different connexins) hemichannels, as well as homotypic (same hemichannel types) and heterotypic (different hemichannel types) complete channels, each with distinct functional properties.

How does the genomic organization of the GJD4 locus in Macaca fascicularis compare to that in humans and other primates?

The genomic organization of the GJD4 locus in Macaca fascicularis shows significant conservation with that of humans and other primates, particularly rhesus macaque (Macaca mulatta). Comparative genomic analysis reveals:

  • In Macaca fascicularis, the GJD4 gene is located on a chromosomal region syntenic to human chromosome 10

  • The exon-intron structure is conserved between macaque and human GJD4 genes

  • Macaca fascicularis and Macaca mulatta share >90% sequence similarity with the human GJD4 gene

  • Conservation extends to the regulatory regions, suggesting similar expression control mechanisms

This high degree of genomic conservation makes Macaca fascicularis an excellent model for studying GJD4 function and regulation. The availability of the Macaca fascicularis genome sequence (completed through whole-genome shotgun sequencing) has facilitated detailed comparative genomic analyses .

What is the tissue-specific expression pattern of GJD4 in Macaca fascicularis and how can it be accurately quantified?

The tissue-specific expression pattern of GJD4 in Macaca fascicularis can be characterized using multiple complementary approaches:

  • RNA-Seq analysis: Deep sequencing of RNA from different tissues provides comprehensive expression profiles. Studies have shown variable expression of many genes across individuals, suggesting GJD4 expression should be carefully evaluated in experimental contexts

  • Quantitative RT-PCR: Using primers specific to Macaca fascicularis GJD4 sequences allows precise quantification of transcript levels across tissues

  • Microarray analysis: Macaca fascicularis-specific gene expression microarrays have been developed based on the draft genome and can be used to profile GJD4 expression

  • Immunohistochemistry/Immunofluorescence: Using validated antibodies that recognize Macaca fascicularis GJD4 to visualize protein expression in tissue sections

  • Western blotting: Quantifying protein levels in tissue lysates

For accurate quantification, normalization to appropriate reference genes is essential, as is the use of multiple biological replicates due to potential individual variation in expression levels. Based on studies in related species, GJD4 is likely expressed in specific regions of the nervous system, cardiovascular tissues, and potentially other organs with functional gap junctions.

What are the key considerations when designing functional assays to evaluate GJD4 channel activity?

When designing functional assays to evaluate GJD4 channel activity, researchers should consider:

  • Expression system selection: Choose between:

    • Cell lines that lack endogenous connexin expression (e.g., communication-deficient HeLa cells)

    • Primary cells from Macaca fascicularis

    • Heterologous expression systems (Xenopus oocytes for electrophysiology)

  • Channel formation verification: Confirm the formation of functional channels using:

    • Immunofluorescence to visualize gap junction plaques

    • Electron microscopy to observe channel structures

    • Western blotting to confirm protein expression

  • Functional assessment methods:

    • Dye transfer assays using gap junction-permeable dyes (e.g., Lucifer Yellow, calcein-AM)

    • Dual whole-cell patch clamp to measure electrical conductance

    • ATP release assays to assess hemichannel activity

    • Ca²⁺ wave propagation assays to evaluate intercellular communication

  • Environmental regulation:

    • Test channel sensitivity to pH, Ca²⁺ concentration, and voltage

    • Evaluate effects of post-translational modifications

    • Assess responses to physiological and pathological stimuli

  • Controls and validation:

    • Include known gap junction blockers (e.g., carbenoxolone, heptanol)

    • Compare with cells expressing well-characterized connexins

    • Use dominant-negative mutations to confirm specificity

These considerations ensure rigorous characterization of GJD4 channel properties and physiological significance.

How can researchers effectively distinguish between GJD4 hemichannel activity and complete gap junction channel function?

Distinguishing between GJD4 hemichannel activity and complete gap junction channel function requires specific experimental approaches:

  • Hemichannel activity assessment:

    • Conduct experiments in low Ca²⁺ extracellular solutions (promotes hemichannel opening)

    • Measure uptake/release of small molecules (e.g., ethidium bromide, propidium iodide)

    • Perform single-cell electrophysiological recordings in isolated cells

    • Assess ATP release under hemichannel-promoting conditions

    • Use time-lapse imaging to detect transient hemichannel opening events

  • Complete gap junction channel assessment:

    • Perform dye transfer assays between coupled cells (e.g., microinjection of Lucifer Yellow)

    • Conduct dual whole-cell patch clamp recordings to measure junctional conductance

    • Evaluate propagation of Ca²⁺ waves between connected cells

    • Assess metabolic coupling using transfer of metabolites between cells

    • Analyze electrical synchronization in cell networks

  • Distinguishing approaches:

    • Use paired versus unpaired cell experimental designs

    • Apply connexin mimetic peptides that specifically block hemichannels but not complete channels

    • Employ mutations that selectively affect hemichannels or complete channels

    • Perform experiments under conditions that favor one channel type over the other (e.g., mechanical stimulation for hemichannels)

By implementing these strategies, researchers can effectively differentiate between the two functional states of GJD4 and characterize their distinct physiological roles.

How has GJD4 protein evolved across primates and what insights does this provide for functional studies?

Evolutionary analysis of GJD4 across primates reveals patterns of conservation and divergence that inform functional studies:

  • Sequence conservation analysis:

    • Core transmembrane domains and extracellular loops show high conservation, reflecting functional constraints on channel formation

    • The C-terminal regulatory domain displays more variation, suggesting species-specific regulation

    • Cysteine residues in extracellular loops are invariant across species, highlighting their critical role in channel docking

  • Phylogenetic relationships:

    • Macaca fascicularis GJD4 shows >90% sequence similarity with human GJD4

    • The genomic organization of GJD4 is similar between macaques and humans

    • Regulatory elements show differential conservation, potentially reflecting adaptations in expression patterns

  • Functional implications:

    • Highly conserved regions likely represent core functional domains

    • Variable regions may contribute to species-specific channel properties or regulation

    • Comparison of post-translational modification sites can reveal conserved regulatory mechanisms

  • Experimental design considerations:

    • Focus mutational studies on conserved residues for insights into fundamental channel properties

    • Investigate species-specific variations to understand adaptive functions

    • Consider how evolutionary divergence might affect interpretation of animal models

This evolutionary perspective provides a framework for interpreting functional data and designing targeted experiments to elucidate conserved and species-specific aspects of GJD4 biology.

What are the key differences between GJD4 from Macaca fascicularis and other model organisms used in connexin research?

Comparative analysis reveals several key differences between GJD4 from Macaca fascicularis and other model organisms:

Model OrganismSequence Similarity to Human GJD4Key DifferencesResearch Applications
Macaca fascicularis>90% Minor differences in C-terminal regulatory domainTranslational research, drug safety studies
Macaca mulatta>90% Very similar to M. fascicularis GJD4Comparative primate studies
Mouse~85% (estimated)Differences in regulatory domains and expression patternsGenetic manipulation, development studies
Rat~85% (estimated)Similar to mouse, with species-specific regulatory elementsElectrophysiology, in vivo studies
Ornithorhynchus anatinus (platypus)<80% (estimated) Substantial divergence reflecting evolutionary distanceEvolutionary studies

These differences impact experimental design and interpretation in several ways:

  • Translational relevance: Macaca fascicularis GJD4 offers greater translational relevance for human applications compared to rodent or other non-primate models

  • Antibody cross-reactivity: Antibodies designed against human GJD4 are more likely to recognize Macaca fascicularis GJD4 than those from more distant species

  • Regulatory mechanisms: Transcriptional and post-translational regulation may differ between species, affecting expression patterns and functional responses

  • Interaction partners: Protein-protein interactions may vary between species, potentially altering channel regulation and cellular functions

  • Pharmacological responses: Drug binding sites and responses to gap junction modulators may differ between species

Understanding these differences is crucial for selecting appropriate model systems and interpreting results in the context of human gap junction biology.

What cutting-edge techniques are being applied to study GJD4 structure, function, and regulation in Macaca fascicularis?

Several cutting-edge techniques are advancing our understanding of GJD4 biology in Macaca fascicularis:

  • Cryo-electron microscopy (Cryo-EM):

    • Enables visualization of connexin channel structure at near-atomic resolution

    • Allows comparison of open versus closed channel states

    • Can reveal conformational changes associated with voltage gating or ligand binding

  • CRISPR/Cas9 genome editing:

    • Facilitates introduction of specific mutations to study structure-function relationships

    • Enables generation of knockout cellular models to assess GJD4 function

    • Can be used to add reporter tags for live imaging of endogenous GJD4

  • Single-cell transcriptomics:

    • Reveals cell type-specific expression patterns across tissues

    • Identifies co-expressed genes that may interact with GJD4

    • Maps expression changes during development or disease progression

  • Super-resolution microscopy:

    • Visualizes gap junction plaque organization beyond the diffraction limit

    • Tracks single-molecule dynamics of GJD4 in living cells

    • Maps protein interactions within functional channels

  • Advanced electrophysiology:

    • Applies patch clamp technologies to study single-channel properties

    • Combines electrical recording with fluorescence imaging

    • Implements high-throughput platforms for pharmacological screening

These technologies provide unprecedented insights into GJD4 biology and facilitate comparative studies between macaque and human connexins.

How can GJD4 research in Macaca fascicularis contribute to the development of therapeutics targeting gap junction channels?

Research on GJD4 in Macaca fascicularis offers several pathways to therapeutic development:

  • Target validation:

    • Establishes the role of GJD4 in disease-relevant physiological processes

    • Confirms conservation of drug targets between macaques and humans

    • Validates genetic or pharmacological interventions in a translational model

  • Drug screening platforms:

    • Develops functional assays using macaque GJD4 for high-throughput screening

    • Identifies compounds that modulate channel opening, closing, or assembly

    • Tests specificity across different connexin subtypes

  • Safety assessment:

    • Evaluates off-target effects of gap junction modulators in macaque models

    • Assesses potential toxicities in both in vitro and in vivo systems

    • Macaca fascicularis is extensively used in drug safety testing due to its similarity to humans

  • Therapeutic approaches:

    • Peptide mimetics based on conserved connexin sequences

    • Small molecule modulators of channel gating or assembly

    • Antisense oligonucleotides or siRNAs to modulate expression levels

    • Gene therapy approaches to correct mutations or expression deficiencies

  • Translational prediction:

    • The high similarity between macaque and human GJD4 (>90%) enhances predictive value

    • Similar pharmacokinetics and pharmacodynamics to humans

    • More reliable efficacy and safety predictions compared to rodent models

The macaque model bridges the gap between basic research and clinical applications, providing a critical translational step in therapeutic development for gap junction-related disorders.

What are the main technical challenges in purifying functional recombinant GJD4 protein and how can they be overcome?

Purifying functional recombinant GJD4 protein presents several technical challenges with corresponding solutions:

  • Membrane protein solubilization:

    • Challenge: GJD4 is a membrane protein with four transmembrane domains, making it difficult to solubilize while maintaining native structure

    • Solution: Use mild detergents (DDM, LMNG, or CHAPS) or amphipols; optimize detergent-to-protein ratios; consider nanodiscs or styrene maleic acid copolymer lipid particles (SMALPs) for membrane-mimetic environments

  • Proper folding during expression:

    • Challenge: Overexpression often leads to misfolding and inclusion body formation

    • Solution: Express at lower temperatures (16-25°C); use specialized E. coli strains designed for membrane proteins; consider eukaryotic expression systems for complex proteins

  • Oligomeric state preservation:

    • Challenge: GJD4 functions as hexamers, which can dissociate during purification

    • Solution: Use cross-linking agents; implement mild purification conditions; apply native gel electrophoresis to monitor oligomeric state; employ size exclusion chromatography

  • Functional verification:

    • Challenge: Confirming that purified protein retains functional capabilities

    • Solution: Develop liposome reconstitution assays; implement electrophysiological measurements in artificial membranes; use structural techniques (circular dichroism, fluorescence spectroscopy) to verify proper folding

  • Scale-up for structural studies:

    • Challenge: Obtaining sufficient quantities of pure, homogeneous protein

    • Solution: Optimize fermentation conditions; implement automated purification; consider insect cell expression for larger-scale production

By addressing these challenges, researchers can obtain functional recombinant GJD4 protein suitable for structural and functional studies.

What strategies can be employed to develop specific antibodies against Macaca fascicularis GJD4 for immunodetection studies?

Developing specific antibodies against Macaca fascicularis GJD4 requires strategic approaches:

  • Epitope selection:

    • Approach: Choose unique extracellular or cytoplasmic regions of GJD4 that differ from other connexins

    • Rationale: Extracellular loops contain connexin-specific sequences but have important disulfide bonds; cytoplasmic loops and the C-terminus offer greater variability between connexins

  • Antigen preparation options:

    • Synthetic peptides conjugated to carrier proteins (for sequence-specific epitopes)

    • Recombinant protein fragments expressed in E. coli (for larger domains)

    • Purified full-length protein in detergent micelles or nanodiscs (for conformational epitopes)

    • DNA immunization encoding GJD4 fragments (for in vivo expression)

  • Antibody production platforms:

    • Polyclonal antibodies: Generate in rabbits or goats using multiple epitopes

    • Monoclonal antibodies: Develop through hybridoma technology or phage display

    • Recombinant antibodies: Engineer using synthetic biology approaches

  • Cross-reactivity testing:

    • Validate against other connexin family members

    • Test in tissues known to express or lack GJD4

    • Validate in GJD4 knockout/knockdown models

    • Compare reactivity against human and macaque GJD4

  • Application-specific optimization:

    • For Western blotting: Test fixation and denaturation conditions

    • For immunohistochemistry: Optimize antigen retrieval methods

    • For immunoprecipitation: Test various lysis and binding conditions

    • For live cell imaging: Develop non-blocking antibodies or nanobodies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.