Recombinant Macaca fascicularis Glycerophosphodiester phosphodiesterase domain-containing protein 4 (GDPD4)

Shipped with Ice Packs
In Stock

Description

Introduction and Functional Overview

Glycerophosphodiester phosphodiesterase domain-containing protein 4 (GDPD4) is a recombinant protein derived from Macaca fascicularis (cynomolgus macaque). It belongs to the glycerophosphodiester phosphodiesterase family, which catalyzes the hydrolysis of glycerophosphodiester bonds in lipid metabolism . The protein is integral to membrane structures and plays roles in lipid processing, with potential links to diseases such as achromatopsia 4 and Van Maldergem syndrome .

Sequence Alignment

A full-length GDPD4 construct from Macaca fascicularis includes a 370-amino acid sequence fused to a His-tag. The N-terminal region contains conserved domains critical for enzymatic activity .

Research Applications and Disease Associations

GDPD4 is utilized in:

  • Lipid Metabolism Studies: Investigating phosphodiesterase activity in membrane lipid remodeling .

  • Disease Modeling: Linked to genetic disorders such as achromatopsia 4 (a vision disorder) and Van Maldergem syndrome .

  • Immunological Research: Recombinant GDPD4 proteins aid in developing antibodies for immunoblotting (WB) or ELISA assays .

References

  1. MyBioSource: Recombinant GDPD4 Proteins for Macaca fascicularis .

  2. GeneCards: Functional annotations and disease associations .

  3. Creative BioMart: Full-length GDPD4 constructs and purification protocols .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
GDPD4; QtsA-10771; QtsA-10831; Glycerophosphodiester phosphodiesterase domain-containing protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-627
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
GDPD4
Target Protein Sequence
MLLFLWIETSNEYFNFDWVIFLGTGYWFYWSIFILSLAGILTAYSSLLLLLGLLLLWEGI ELYLHLCHKILILLVILPCVILMFIICKFWKERWLVAGLSLQIFAPYVHLVSITVMVILF WPVAIYVARLEREVRMRRYRMTHSEKKRLKKCNVIARLRGLQVAVGLPFLLIFLSLCLMP LGIYSPCIQEKENLGPKPTLFGHRGAPMLGPENTMMSFEKAVEHGAHGLETDVHLSYDRV PFLMHDFDLRRTTNIREVQPESAFKNPATFSWDFLSTLNAGKWFVKPELKPFYNMKPLSK ADKERARNQSIPTLADLLTLAKKERKFVIFDLRGPPPRHPLRHTFVRQVVSVILASKIEQ HLIFWLPAHDRRYVRSMAPGFQHVGHLVSVKTLAKNNISIINVDYKKLFPNGLRDYKAAN IRINVYTINEPWLFSLAWCSRINSVTTDNIGLLSQLNHPHFFMTPKFYMFIWLLVDIISV LFIVAIFCFHWRRETIKEKLFETSSTLTDTQSRSENEEDLHIAMKPARVVESPWTLAALY PALSKSGKEHQGRFNFAAPSKKLVPIKNAVTPLKPGKHDIQPPMPTTVFELTQAPSRQAK SKATFQTTLPTLKVDKPTMPSVEVPYP
Uniprot No.

Target Background

Database Links

UniGene: Mfa.1633

Protein Families
Glycerophosphoryl diester phosphodiesterase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Glycerophosphodiester Phosphodiesterase Domain-Containing Protein 4 (GDPD4)?

GDPD4 is a protein-coding gene that encodes an enzyme involved in glycerophospholipid metabolism. The protein is predicted to enable metal ion binding activity and phosphoric diester hydrolase activity. It is also predicted to be an integral component of membrane structures and plays a role in lipid metabolic processes. GDPD4 contains specialized domains that enable its enzymatic function in hydrolyzing glycerophosphodiesters, which are important components of cellular membranes .

What are the structural characteristics of Macaca fascicularis GDPD4?

Macaca fascicularis GDPD4 shares significant structural homology with human GDPD4. The protein contains conserved glycerophosphodiester phosphodiesterase domains that are critical for its catalytic function. Recombinant versions of this protein can be produced with greater than 85% purity as determined by SDS-PAGE analysis, suggesting a relatively stable tertiary structure suitable for in vitro studies . The protein's structural integrity is maintained across expression systems, including cell-free expression platforms commonly used for recombinant protein production.

How does Macaca fascicularis GDPD4 compare to human GDPD4?

Macaca fascicularis GDPD4 shares significant sequence and functional homology with human GDPD4 (also known as GDE6). Both proteins contain conserved glycerophosphodiester phosphodiesterase domains and are predicted to have similar enzymatic functions. This high degree of conservation makes Macaca fascicularis GDPD4 a valuable model for studying human GDPD4 function and associated pathways . Researchers often use this orthologous relationship to extrapolate findings between non-human primate models and human systems.

What expression systems are most effective for producing recombinant Macaca fascicularis GDPD4?

Cell-free expression systems have been successfully employed to produce recombinant Macaca fascicularis GDPD4 with high purity levels (≥85% as determined by SDS-PAGE) . This approach offers advantages for proteins that may be challenging to express in traditional cellular systems. Alternative expression platforms including E. coli, yeast, baculovirus, and mammalian cell systems have also been used for partial GDPD4 constructs, allowing researchers to select the optimal system based on downstream applications and experimental requirements .

What purification strategies yield the highest quality recombinant Macaca fascicularis GDPD4?

Effective purification of recombinant Macaca fascicularis GDPD4 typically involves a multi-step process that begins with affinity chromatography, often using tagged constructs. Current production methods can achieve greater than 85% purity as determined by SDS-PAGE analysis . For highest purity preparations, researchers often implement secondary purification steps such as size exclusion chromatography or ion exchange chromatography to remove aggregates and contaminants. Protein stability during purification can be enhanced by optimizing buffer conditions, including pH, salt concentration, and the addition of stabilizing agents.

How should experimental design be optimized when studying GDPD4 function?

When designing experiments to study GDPD4 function, proper randomization is critical to avoid confounding factors that could lead to spurious associations. Approximately 95% of studies face challenges with experimental design, particularly related to randomization of sample collection or experimental order with respect to phenotypes of interest . To mitigate these issues, researchers should:

  • Randomize sample plating and processing

  • Include appropriate controls (positive, negative, and technical)

  • Blind experimenters to sample identity when possible

  • Use consistent protocols across experimental batches

  • Consider potential batch effects in data analysis

Failure to address these design elements may result in experimental artifacts that cannot be distinguished from true biological effects .

What are the implications of GDPD4 mutations in disease contexts?

GDPD4 mutations have been associated with several diseases, including Achromatopsia 4 and Van Maldergem Syndrome . Research using recombinant GDPD4 can help elucidate the molecular mechanisms underlying these conditions. Additionally, GDPD4 has been studied in the context of cancer research through databases like COSMIC, which tracks mutations across various tissue types . Understanding the structural and functional consequences of these mutations requires sophisticated biochemical and cellular assays using well-characterized recombinant protein.

How can recombinant Macaca fascicularis GDPD4 be used in drug discovery pipelines?

Recombinant Macaca fascicularis GDPD4 serves as a valuable tool in drug discovery pipelines, particularly for developing compounds that target glycerophospholipid metabolism. The protein can be used in:

  • High-throughput screening assays to identify potential inhibitors

  • Structure-activity relationship studies to optimize lead compounds

  • Binding affinity assessments using techniques such as surface plasmon resonance

  • Enzymatic activity assays to evaluate compound efficacy

GDPD4 mutations have been associated with drug resistance in some contexts, making this protein an important target for understanding therapeutic response mechanisms .

What techniques are most effective for studying GDPD4 protein-protein interactions?

To investigate GDPD4 protein-protein interactions, researchers can employ multiple complementary approaches:

  • Co-immunoprecipitation using antibodies against recombinant GDPD4

  • Proximity labeling techniques (BioID or APEX) to identify interaction partners in cellular contexts

  • Yeast two-hybrid screening for potential binding partners

  • Surface plasmon resonance or biolayer interferometry to measure binding kinetics

  • Crosslinking mass spectrometry to map interaction interfaces

These methods can reveal GDPD4's role in larger protein complexes and signaling networks, providing insight into its cellular functions beyond enzymatic activity.

How can researchers address stability issues with recombinant Macaca fascicularis GDPD4?

Recombinant GDPD4 may present stability challenges during storage and experimental use. To address these issues, researchers should:

  • Optimize buffer conditions (pH, salt concentration, reducing agents)

  • Include appropriate stabilizing agents (glycerol, trehalose, etc.)

  • Store aliquoted protein at -80°C to minimize freeze-thaw cycles

  • Consider the addition of protease inhibitors to prevent degradation

  • Test activity immediately before use in critical experiments

For long-term projects, researchers may need to produce fresh batches of protein periodically to ensure consistent activity levels throughout the study.

What are the best approaches for validating the enzymatic activity of recombinant GDPD4?

Validating the enzymatic activity of recombinant GDPD4 requires carefully designed assays that reflect its predicted phosphodiester hydrolase function. Effective validation strategies include:

  • Spectrophotometric assays measuring glycerophosphodiester hydrolysis

  • Mass spectrometry to detect reaction products

  • Isothermal titration calorimetry to measure reaction thermodynamics

  • Comparisons with known enzymatic standards

  • Site-directed mutagenesis of catalytic residues as negative controls

Researchers should also consider the role of metal ions, as GDPD4 is predicted to have metal ion binding activity that may be essential for its catalytic function .

How can researchers distinguish between GDPD4 and its paralog GDPD5 in experimental systems?

Distinguishing between GDPD4 and its important paralog GDPD5 requires careful experimental design and validation:

  • Use of highly specific antibodies that have been validated against both recombinant proteins

  • Design of paralog-specific primers for qPCR analysis

  • CRISPR-Cas9 knockout approaches targeting unique regions

  • Expression of tagged versions with distinct epitopes for simultaneous detection

  • Paralog-specific activity assays based on subtle differences in substrate preferences

These approaches allow researchers to delineate the distinct functions of these related proteins and avoid misattribution of observed phenotypes.

What statistical approaches are recommended for analyzing GDPD4 experimental data?

When analyzing experimental data related to GDPD4, researchers should implement robust statistical approaches that account for common challenges in biological experiments:

  • Control for batch effects and technical variability

  • Apply appropriate normalization methods for the specific data type

  • Use statistical tests that align with the data distribution (parametric vs. non-parametric)

  • Implement multiple testing correction for high-throughput data

  • Consider mixed-effects models when working with repeated measures

Poor experimental design, particularly regarding randomization, can lead to confounding factors that make it impossible to distinguish true biological effects from artifacts . Therefore, statistical analysis should be planned during experimental design rather than applied post-hoc.

How should researchers interpret contradictory findings in GDPD4 literature?

When encountering contradictory findings in GDPD4 literature, researchers should systematically evaluate:

  • Differences in experimental systems (cell lines, expression constructs, etc.)

  • Variations in methodological approaches and their limitations

  • Quality of experimental design, particularly regarding randomization and controls

  • Sample sizes and statistical power of comparative studies

  • Potential batch effects or confounding variables

Resolving contradictions often requires direct replication studies or meta-analyses that integrate findings across multiple studies while accounting for methodological differences.

What are emerging areas of GDPD4 research that show particular promise?

Emerging areas in GDPD4 research include:

  • Role in lipid metabolism regulation and membrane remodeling

  • Potential contributions to neurological disorders beyond known disease associations

  • Involvement in cell signaling pathways, particularly those related to phospholipid metabolism

  • Structural biology approaches to elucidate catalytic mechanisms

  • Development of specific inhibitors for research and potential therapeutic applications

The predicted roles of GDPD4 in phosphoric diester hydrolase activity and glycerophosphodiester phosphodiesterase activity suggest broader functional implications that remain to be fully characterized .

How might single-cell approaches advance our understanding of GDPD4 function?

Single-cell approaches offer powerful new ways to investigate GDPD4 function:

  • Single-cell RNA sequencing to map GDPD4 expression patterns across cell types and states

  • Single-cell proteomics to quantify protein abundance in rare cell populations

  • CRISPR screens at single-cell resolution to identify genetic interactions

  • Live-cell imaging with fluorescent reporters to monitor dynamics in real time

  • Single-cell metabolomics to connect GDPD4 activity to cellular lipid profiles

These approaches can reveal cell-type-specific functions and heterogeneity in GDPD4 activity that might be masked in bulk population analyses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.