Recombinant Macaca fascicularis Kidney mitochondrial carrier protein 1 (SLC25A30)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for precise delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is preferred, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is discouraged. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its implementation.
Synonyms
SLC25A30; KMCP1; QflA-20343; Kidney mitochondrial carrier protein 1; Solute carrier family 25 member 30
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
SLC25A30
Target Protein Sequence
MSALNWKPFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIG REEGLKALYSGIAPAMLRQSSYGTIKIGTYQSLKRLFVERPEDETLLINVICGILSGVIS STIANPTDVLKIRMQAQSSTIQGGMIGNFMNIYQQEGTRGLWKGVSLTAQRAAIVVGVEL PVYDITKKHLILSGLMGDTVYTHFLSSFTCGLAGALASNPVDVVRTRMMNQRVLQDGRCS GYTGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIILFVTYEQLKKLDL
Uniprot No.

Target Background

Function
Probable transporter.
Database Links

UniGene: Mfa.1756

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the primary role of SLC25A30 in mitochondrial transport?

SLC25A30 functions as a specialized transport protein in the inner mitochondrial membrane, facilitating the movement of metabolites between the mitochondrial matrix and cytosol. While the outer mitochondrial membrane is relatively permeable to small molecules, the inner membrane requires dedicated carrier proteins like SLC25A30 to maintain selective permeability and support proper mitochondrial function . The protein plays a crucial role in maintaining mitochondrial homeostasis and contributes to cellular energy metabolism through its transport activities. Research suggests it may be particularly important for kidney tissue function, as indicated by its alternative name (kidney mitochondrial carrier protein 1).

How does SLC25A30 gene organization compare between human and non-human primates?

In humans, the SLC25A30 gene is located on chromosome 13q14.13 and consists of 13 exons spanning approximately 40.7 kb (45,393,316-45,434,016) . The gene structure in Macaca fascicularis shows high conservation with humans, reflecting their evolutionary proximity. When designing experiments with recombinant Macaca fascicularis SLC25A30, researchers should account for the specific exon organization and potential splice variants that might affect protein function. The high degree of homology between human and macaque SLC25A30 (>95% at the amino acid level) makes the monkey protein an excellent model for human SLC25A30 studies.

What interaction partners are known for SLC25A30?

SLC25A30 engages in direct protein-protein interactions that influence its transport function and regulation. While specific interacting partners are not fully characterized in the provided search results, research approaches such as yeast two-hybrid, co-immunoprecipitation (co-IP), and pull-down assays have been employed to identify potential binding partners . Understanding these interactions is crucial for interpreting SLC25A30 function in different cellular contexts and may provide insights into tissue-specific roles of this mitochondrial carrier protein.

What expression systems are optimal for producing functional recombinant Macaca fascicularis SLC25A30?

Multiple expression systems have been successfully employed for recombinant SLC25A30 production, each with distinct advantages depending on research objectives:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, economical, rapid productionMay lack proper post-translational modifications
Mammalian cells (HEK293)Native-like folding and modificationsLower yield, more resource-intensive
SUMO fusion systemsEnhanced solubility, reduced aggregationRequires additional tag removal step
His-tagged constructsSimplified purification via affinity chromatographyMay affect protein activity in some contexts

For studies requiring functional transport assays, mammalian expression systems like HEK293 cells generally provide superior results due to their ability to properly fold membrane proteins and introduce relevant post-translational modifications . When using E. coli-based systems, consider adding solubility tags like SUMO to enhance proper folding of this membrane protein.

How can I verify the functionality of recombinant SLC25A30 after purification?

Verification of recombinant SLC25A30 functionality requires multiple complementary approaches:

  • Transport activity assays: Reconstitute purified protein into liposomes loaded with fluorescent substrates to measure transport kinetics.

  • ATPase activity measurements: Quantify ATP hydrolysis rates in the presence of potential substrates to assess functional integrity.

  • Circular dichroism spectroscopy: Confirm proper secondary structure formation, particularly important for alpha-helical membrane proteins like SLC25A30.

  • Thermal shift assays: Evaluate protein stability under different buffer conditions to optimize storage and experimental conditions.

  • Complementation assays: Introduce recombinant SLC25A30 into knockout cell lines (like the SLC25A30 KO HEK293 line) to assess functional rescue of phenotypes .

For definitive functional validation, mitochondrial respiration measurements in complemented knockout cells provide the most physiologically relevant assessment of carrier activity.

What PCR-based methods are recommended for SLC25A30 expression analysis?

For accurate quantification of SLC25A30 expression, validated qPCR assays are available with the following specifications:

ParameterValue
Assay efficiency97%
R² value0.9982
cDNA Cq22.29
Melting temperature79.5°C
Amplicon length64 bp
Specificity100%

The primers are designed to span exons, helping to minimize genomic DNA interference in expression studies. For optimal results when analyzing SLC25A30 expression, researchers should use SsoAdvanced SYBR Green Supermix or equivalent reagents and implement a standard curve ranging from 20 to 20 million copies . This approach allows for reliable detection of SLC25A30 transcript levels across different experimental conditions.

How do I interpret discrepancies between in vitro and cellular SLC25A30 activity?

Discrepancies between in vitro and cellular SLC25A30 activity are common and can arise from several factors:

  • Membrane environment differences: The lipid composition of artificial membranes in vitro often differs from the native mitochondrial inner membrane, affecting protein conformation and activity.

  • Missing cofactors or regulators: Cellular environments contain numerous cofactors, ions, and regulatory proteins that may be absent in purified systems.

  • Post-translational modifications: Cellular SLC25A30 undergoes various modifications that may be absent in recombinant proteins expressed in heterologous systems.

  • Oligomerization state: SLC25A30 may function as part of larger protein complexes in vivo that aren't fully recapitulated in vitro.

To address these discrepancies, implement parallel experiments comparing recombinant protein activity with native protein in mitochondrial preparations, and consider complementation studies in SLC25A30 knockout cell lines . Additionally, evaluate the impact of lipid composition on transport activity by systematically varying liposome composition in reconstitution experiments.

What controls are essential for SLC25A30 knockout validation experiments?

When using SLC25A30 knockout cell lines such as the HEK293 KO line, implement the following controls to ensure reliable data interpretation:

  • Wild-type cells: Always include the parental cell line as a positive control for normal SLC25A30 expression and function.

  • Rescue experiments: Re-express SLC25A30 in knockout cells to confirm phenotypes are specifically due to SLC25A30 loss.

  • Off-target effect assessment: Verify that other mitochondrial carriers remain unaffected using transcriptomic or proteomic approaches.

  • Mycoplasma testing: Ensure cells are mycoplasma-negative as indicated for commercial lines (negative status is standard for research-grade lines) .

  • Functional readouts: Implement multiple functional assays (e.g., respiration, membrane potential, ROS production) to comprehensively characterize the impact of SLC25A30 loss.

These controls help distinguish between specific effects of SLC25A30 knockout and general mitochondrial dysfunction or adaptation to genetic manipulation.

How can I leverage SLC25A30 knockout models to study mitochondrial metabolism?

SLC25A30 knockout models provide powerful platforms for investigating mitochondrial transport and metabolism:

  • Metabolic flux analysis: Apply stable isotope labeling to track alterations in metabolite flow through central carbon metabolism pathways in knockout versus wild-type cells.

  • Stress response characterization: Challenge knockout cells with various stressors (oxidative, metabolic, thermal) to uncover conditional phenotypes that reveal SLC25A30's role in stress adaptation.

  • Compensatory mechanism identification: Perform transcriptomic and proteomic analyses to identify upregulated pathways that compensate for SLC25A30 loss, revealing functional redundancy in mitochondrial transport systems.

  • Drug sensitivity profiling: Screen knockout cells against compound libraries to identify enhanced sensitivity or resistance that points to therapeutic vulnerabilities or synergies .

  • Interactome mapping: Use proximity labeling approaches in wild-type versus knockout backgrounds to map the protein interaction network influenced by SLC25A30 presence.

When implementing these approaches, maintain consistent culture conditions (90% DMEM + 10% FBS for HEK293-based models) to minimize variability from non-specific metabolic adaptations .

What approaches effectively elucidate SLC25A30's role in oxidative stress responses?

To investigate SLC25A30's involvement in oxidative stress responses, implement the following methodological approaches:

  • ROS measurement assays: Use fluorescent probes (e.g., DCF-DA, MitoSOX) to quantify compartment-specific ROS levels in wild-type versus SLC25A30-deficient cells under basal and stress conditions.

  • Antioxidant system analysis: Assess glutathione levels, thioredoxin system activity, and antioxidant enzyme expression to determine if SLC25A30 loss alters cellular redox management capabilities.

  • Mitochondrial membrane potential monitoring: Track changes in membrane potential (Δψm) using potentiometric dyes to evaluate how SLC25A30 affects the proton gradient that drives ATP synthesis.

  • Lipid peroxidation assessment: Quantify lipid peroxidation products as indicators of oxidative damage to membrane structures in the presence or absence of SLC25A30.

  • Mitochondrial morphology analysis: Examine changes in mitochondrial network structure and dynamics, as altered transport function often manifests as changes in organelle morphology.

These approaches collectively provide a comprehensive view of how SLC25A30 contributes to cellular redox homeostasis and mitochondrial function under oxidative stress conditions.

Why might recombinant SLC25A30 show low activity in transport assays?

Low activity of recombinant SLC25A30 in transport assays can stem from several issues:

  • Improper folding: As a membrane protein, SLC25A30 requires a hydrophobic environment for proper folding. Consider using detergent screens to identify optimal solubilization conditions.

  • Inactive conformation: The protein may be trapped in an inactive conformational state. Try adding potential substrates or cofactors during purification to stabilize the active conformation.

  • Suboptimal reconstitution: The protein-to-lipid ratio in proteoliposomes is critical. Optimize this ratio through systematic variation and activity testing.

  • Orientation in liposomes: SLC25A30 must be properly oriented in the membrane to function. Assess protein orientation using protease protection assays or antibodies against epitope tags placed at known topological locations.

  • Missing interacting partners: Some carrier proteins require accessory subunits for full activity. Consider co-expressing SLC25A30 with potential partners identified in interaction studies .

If using E. coli-expressed protein, shifting to a eukaryotic expression system like HEK293 cells may yield more active protein due to proper post-translational modifications and folding machinery.

How can I address aggregation issues with purified SLC25A30?

Protein aggregation is a common challenge with membrane proteins like SLC25A30. Implement these strategies to minimize aggregation:

  • Optimize detergent selection: Screen multiple detergent types (mild non-ionic detergents like DDM or LMNG often work well for mitochondrial carriers).

  • Include stabilizing additives: Add glycerol (10-15%), specific lipids (cardiolipin is important for mitochondrial carriers), or osmolytes like sucrose to buffer solutions.

  • Maintain low protein concentration: Keep purified protein at low concentration (~1 mg/mL) and avoid freeze-thaw cycles.

  • Use fusion tags: Express SLC25A30 with solubility-enhancing tags such as SUMO, which can be removed after purification .

  • Perform SEC-MALS analysis: Use size exclusion chromatography coupled with multi-angle light scattering to monitor oligomeric state and aggregation propensity under different conditions.

  • Consider amphipols or nanodiscs: These alternatives to detergents can provide a more native-like environment and enhance stability of membrane proteins.

For long-term storage, flash-freeze small aliquots in liquid nitrogen and store at -80°C with cryoprotectants to minimize damage from freeze-thaw cycles.

What strategies help resolve inconsistent expression of SLC25A30 in cell models?

Inconsistent expression of SLC25A30 in experimental cell models may be addressed through several approaches:

  • Codon optimization: Adjust codon usage for optimal expression in your host cell system, particularly important for cross-species expression of Macaca fascicularis SLC25A30 in other systems.

  • Inducible expression systems: Implement tetracycline-inducible or similar systems to control expression timing and level, reducing potential toxicity from overexpression.

  • Clone selection: Isolate and characterize single-cell clones with stable expression profiles rather than using mixed populations.

  • Genomic integration site control: Use targeted integration approaches (e.g., CRISPR-mediated knock-in at safe harbor loci) to minimize position effects on expression.

  • Verify transcript stability: Assess mRNA half-life using actinomycin D chase experiments if expression decreases over time, as rapid mRNA turnover can cause inconsistent protein levels.

When monitoring expression, utilize validated qPCR assays with proven efficiency (97%) and specificity (100%) as described in the literature , and confirm protein expression using validated antibodies against SLC25A30 or epitope tags.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.