Recombinant Macaca fascicularis Lysosomal-associated transmembrane protein 4B (LAPTM4B)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. If you have a specific format requirement, kindly indicate it when placing your order and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
LAPTM4B; QtsA-18169; Lysosomal-associated transmembrane protein 4B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
LAPTM4B
Target Protein Sequence
MKMVAPWTRFYSNSCCLCCHVRTGTILLGVWYLIINAVVLLILLSALADPDQYHFSSSEL GGDFEFMDDANMCIAIAISLLMILICAMATYGAYKQRAAWIIPFFCYQIFDFALNTLVAI TVLVYPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLISCVWNCY RYINGRNSSDVLVYVTSNDTTVLLPPYDDATVNGAAKEPPPPYVSA
Uniprot No.

Target Background

Function
Recombinant Macaca fascicularis Lysosomal-associated transmembrane protein 4B (LAPTM4B) is essential for optimal lysosomal function. It inhibits EGF-stimulated EGFR intraluminal sorting and degradation. Furthermore, by interacting with phosphatidylinositol 4,5-bisphosphate, it regulates its PIP5K1C interaction, inhibits HGS ubiquitination, and relieves LAPTM4B inhibition of EGFR degradation. LAPTM4B recruits SLC3A2 and SLC7A5 (the Leu transporter) to the lysosome, facilitating the entry of leucine and other essential amino acids (EAA) into the lysosome. This process stimulates the activation of the proton-transporting vacuolar (V)-ATPase protein pump (V-ATPase) and consequently, mTORC1 activation. LAPTM4B acts as a negative regulator of TGFB1 production in regulatory T cells. It binds ceramide and facilitates its exit from the late endosome, thereby controlling cell death pathways.
Database Links

UniGene: Mfa.2111

Protein Families
LAPTM4/LAPTM5 transporter family
Subcellular Location
Endomembrane system; Multi-pass membrane protein. Late endosome membrane. Cell membrane. Cell projection. Lysosome membrane. Endosome membrane. Endosome, multivesicular body membrane. Endosome, multivesicular body lumen.

Q&A

What is LAPTM4B and what are its primary functions in cell biology?

LAPTM4B (Lysosomal-associated transmembrane protein 4B) belongs to a family of transmembrane glycoproteins with four to five transmembrane domains. It shares structural homology with other family members, including LAPTM4A and LAPTM5, with sequence identities of 46% and 23%, respectively . LAPTM4B's primary functions include:

  • Regulation of TGF-β1 production in regulatory T cells (Tregs), where it acts as a negative regulator by binding to glycoprotein A repetitions predominant (GARP) . This interaction decreases cleavage of proTGF-β1, reduces secretion of soluble latent TGF-β1, and diminishes surface presentation of GARP·TGF-β1 complexes.

  • Oncogenic roles in various cancers, where elevated expression levels correlate with poor prognosis. LAPTM4B enhances cell proliferation, migration, invasion, tumorigenesis, and metastasis through multiple mechanisms .

  • Interaction with the EGFR signaling pathway, where it enhances prosurvival functions by blocking lysosomal degradation of activated EGF receptor and initiating cell-protective autophagy in the absence of EGF .

The protein's localization in lysosomal membranes suggests its involvement in protein trafficking and degradation pathways similar to other lysosomal membrane proteins, though with distinct regulatory mechanisms from related proteins like TMBIM1 .

How does the structure of Macaca fascicularis LAPTM4B differ from human LAPTM4B?

While the search results do not provide specific structural comparisons between human and Macaca fascicularis LAPTM4B, understanding these differences is crucial for research translation. The Macaca fascicularis (cynomolgus monkey) model serves as an important preclinical research tool due to its close evolutionary relationship with humans .

Key structural considerations include:

  • Conservation of functional domains: Both human and macaque LAPTM4B contain the characteristic transmembrane domains and C-terminal polyproline-tyrosine (PY) motifs that are essential for lysosomal targeting .

  • Isoform diversity: Human LAPTM4B exists in at least two isoforms (LAPTM4B iso20 and LAPTM4B iso24), with the latter containing an additional 66 amino acids at the N-terminus . Similar isoform diversity may exist in the macaque version, though specific documentation is limited.

  • Post-translational modifications: Glycosylation patterns may differ between species, potentially affecting protein stability, trafficking, or interaction capabilities.

  • Sequence homology: While exact percentages are not provided in the search results, non-human primates typically show >90% sequence identity with human proteins, with conservation highest in functional domains.

Researchers working with recombinant Macaca fascicularis LAPTM4B should conduct sequence alignment analyses to identify potential structural differences that might impact experimental interpretations when translating findings to human systems.

What expression systems are optimal for producing recombinant Macaca fascicularis LAPTM4B?

The production of functional recombinant LAPTM4B requires careful consideration of expression systems that can properly process this multi-transmembrane protein. Based on research practices with similar proteins, researchers should consider:

  • Mammalian expression systems: HEK293T cells have been successfully used for expressing LAPTM4B in research settings, demonstrating proper protein folding and functional interactions with partners like GARP . These systems provide appropriate post-translational modifications crucial for LAPTM4B function.

  • Baculovirus-insect cell systems: These provide a eukaryotic environment with proper folding machinery while offering higher protein yields than mammalian systems.

  • Cell-free systems: For structural studies requiring higher purity, cell-free systems with added microsomal membranes might be employed, though functionality testing would be essential.

For functional studies, transfection-based approaches using plasmid constructs have proven effective. In the documented research, constructs encoding both LAPTM4B iso24 and LAPTM4B iso20 isoforms were used, with HA-tagging to facilitate detection . When designing expression constructs for Macaca fascicularis LAPTM4B, ensure inclusion of appropriate epitope tags that don't interfere with protein function, particularly considering the importance of both N- and C-terminal regions in LAPTM4B's interactions and localization.

What are the established methods for detecting LAPTM4B expression and localization?

Accurate detection of LAPTM4B expression and localization requires multiple complementary techniques:

  • Western blotting: Effective for quantifying total protein expression levels and identifying specific isoforms. Previous studies successfully detected both precursor and processed forms of LAPTM4B using this method . For optimal results, sample preparation should include appropriate detergents for membrane protein solubilization.

  • Flow cytometry: Useful for assessing surface expression levels of LAPTM4B in cell populations. Studies have shown that surface LAPTM4B levels can be quantitatively measured, revealing a 45-67% reduction in surface expression upon certain cellular conditions .

  • Immunofluorescence microscopy: Essential for determining subcellular localization. Confocal microscopy has revealed that LAPTM4B colocalizes with GARP and with lysosomal markers . Co-staining with organelle markers such as LysoTracker or LAMP2 can confirm lysosomal localization.

  • Real-time PCR: While protein-level detection is preferable for functional studies, qRT-PCR provides a sensitive method for quantifying mRNA expression levels of LAPTM4B, helping distinguish between transcriptional and post-transcriptional regulation mechanisms.

For all antibody-based detection methods, validation is crucial due to potential cross-reactivity with other LAPTM family members. Using tagged recombinant proteins alongside native protein detection can help confirm antibody specificity.

How does LAPTM4B modulate the TGF-β1 signaling pathway in regulatory T cells?

LAPTM4B plays a sophisticated role in regulating TGF-β1 signaling in Tregs through multiple mechanisms, representing a novel immune regulatory pathway. The process involves:

  • Direct interaction with GARP: LAPTM4B physically binds to GARP as confirmed through protein complementation assays using humanized Gaussia luciferase fragments (hGLuc1 and hGLuc2) . This interaction occurs with both LAPTM4B iso20 and LAPTM4B iso24 isoforms, indicating that the N-terminal 66 amino acids unique to iso24 are not required for GARP binding .

  • Inhibition of proTGF-β1 processing: LAPTM4B significantly decreases the GARP-induced cleavage of proTGF-β1 into latent TGF-β1, as demonstrated through Western blot analysis showing reduced LAP and mature TGF-β1 levels . This represents a critical regulatory step in TGF-β1 production.

  • Reduction of surface GARP·TGF-β1 complexes: Flow cytometry analysis revealed that LAPTM4B overexpression reduces surface GARP levels by 67% and surface LAP by 73% in cells expressing both GARP and TGF-β1 . This effect appears specific, as surface levels of unrelated proteins (HLA-A2, CD9) remain unaffected.

  • Inhibition of latent TGF-β1 secretion: ELISA measurements have shown that LAPTM4B inhibits the secretion of latent TGF-β1 in cell culture supernatants .

  • No effect on latent TGF-β1 activation: LAPTM4B does not appear to influence the activation of latent TGF-β1, as demonstrated using a SMAD2/3-responsive luciferase reporter assay .

The table below summarizes the effects of LAPTM4B on TGF-β1 pathway regulation:

TGF-β1 Regulatory ProcessEffect of LAPTM4BExperimental Evidence
ProTGF-β1 cleavageInhibitionWestern blot showing reduced LAP and mature TGF-β1
Surface GARP levels67% reductionFlow cytometry quantification
Surface LAP levels73% reductionFlow cytometry quantification
Latent TGF-β1 secretionInhibitionELISA of culture supernatants
Latent TGF-β1 activationNo effectSMAD2/3-responsive luciferase reporter

These findings suggest that LAPTM4B functions as a negative regulator of TGF-β1 production in Tregs, potentially serving as a brake on immunosuppressive functions by decreasing available TGF-β1 .

What techniques are most effective for studying LAPTM4B trafficking in cellular models?

Understanding LAPTM4B trafficking requires sophisticated methodological approaches that can track protein movement through various cellular compartments. Based on research with similar lysosomal proteins, the following techniques are recommended:

  • Live-cell imaging with fluorescently tagged LAPTM4B: This approach allows real-time visualization of protein trafficking. Researchers should consider:

    • Using photoactivatable or photoconvertible fluorescent tags to pulse-chase specific protein populations

    • Implementing spinning disk confocal microscopy for longer-term imaging with reduced phototoxicity

    • Combining with organelle markers like LysoTracker for colocalization studies

  • Pulse-chase assays with surface biotinylation: This biochemical approach can quantitatively measure internalization and degradation rates. Studies with the related lysosomal protein TMBIM1 have employed similar approaches to track protein degradation in the presence of cycloheximide .

  • Subcellular fractionation: Density gradient centrifugation to isolate distinct membrane compartments (plasma membrane, early endosomes, late endosomes, lysosomes), followed by Western blotting for LAPTM4B detection can map the protein's distribution.

  • Proximity labeling techniques: BioID or APEX2 fusion proteins can identify transient interaction partners during trafficking, providing a spatiotemporal map of LAPTM4B movement through cellular compartments.

  • Fluorescence Recovery After Photobleaching (FRAP): To measure LAPTM4B mobility within membranes and exchange rates between compartments.

When designing trafficking studies, researchers should consider:

  • Inclusion of appropriate controls (e.g., trafficking-defective mutants)

  • Use of trafficking inhibitors to block specific pathways (e.g., chloroquine for lysosomal degradation)

  • Comparison between different cell types, as trafficking pathways may vary between immune cells and other cell types

The existing research demonstrates that chloroquine (a lysosome inhibitor) but not MG132 (a proteasome inhibitor) blocks LAPTM4B-mediated protein degradation, confirming the lysosomal pathway's importance .

How do LAPTM4B isoforms differ in their functional properties?

LAPTM4B exists in multiple isoforms with distinct functional characteristics that are critical to understand for accurate experimental design and interpretation:

  • Structural differences: Human LAPTM4B has at least two documented isoforms:

    • LAPTM4B iso20: The shorter isoform

    • LAPTM4B iso24: Contains an additional 66 amino acids at the N-terminus compared to iso20

  • Interaction capabilities: Both isoforms interact with GARP in mammalian cells, as demonstrated through protein complementation assays using luciferase fragments . This suggests that the N-terminal extension in iso24 is not essential for GARP binding.

  • Expression patterns: While not explicitly stated in the search results for Macaca fascicularis, human studies indicate differential expression patterns of LAPTM4B isoforms across tissues and disease states.

  • Subcellular localization: The isoforms may have subtle differences in trafficking or membrane domain localization due to the N-terminal differences, though they share core lysosomal targeting sequences including C-terminal polyproline-tyrosine (PY) motifs .

  • Regulatory functions: While both isoforms appear to inhibit TGF-β1 production, potential differences in their regulatory efficacy have not been fully characterized.

For researchers working with recombinant LAPTM4B, it is advisable to:

  • Clearly specify which isoform is being studied in all experimental reports

  • Consider including multiple isoforms in comparative studies to identify functional differences

  • Use isoform-specific detection methods when possible

  • Design constructs that accurately represent the natural isoform sequences, including appropriate start codons and post-translational modification sites

The documented LAPTM4B construct design approach, encoding both iso24 and iso20 from a single construct (with only iso24 tagged with HA), provides a useful model for expression studies that aim to recapitulate natural isoform production .

What are the methodological challenges in studying LAPTM4B-protein interactions?

Investigating LAPTM4B interactions presents several methodological challenges that researchers must address:

  • Membrane protein solubilization: As a multi-transmembrane protein, LAPTM4B requires careful solubilization strategies that maintain protein-protein interactions while extracting it from membranes. Recommended approaches include:

    • Mild detergents (e.g., digitonin, CHAPS, or DDM) at optimized concentrations

    • Nanodiscs or styrene maleic acid lipid particles (SMALPs) for native-like membrane environment preservation

    • Crosslinking prior to solubilization for capturing transient interactions

  • Confirmation of direct interactions: Multiple complementary methods should be employed:

    • Yeast two-hybrid assays: Successfully used to identify LAPTM4B-GARP interactions

    • Protein complementation assays: The split-luciferase approach (using hGLuc1 and hGLuc2 fragments) provided robust confirmation of LAPTM4B-GARP interaction in mammalian cells

    • Co-immunoprecipitation: Essential for confirming interactions in native cellular contexts

    • Proximity labeling: BioID or APEX2 approaches can identify the broader interactome

  • Subcellular localization considerations: LAPTM4B interactions may be compartment-specific. Fluorescence microscopy revealed that LAPTM4B and GARP colocalize primarily in the median Golgi, not in lysosomes as might be expected based on LAPTM4B's classification . This suggests:

    • Interactions should be studied in specific subcellular compartments

    • The cellular context significantly influences interaction dynamics

    • Potential interactions may vary throughout trafficking pathways

  • Functional validation of interactions: Demonstrating the functional significance of interactions requires specialized assays:

    • Western blot analysis of TGF-β1 processing with and without LAPTM4B expression

    • Flow cytometry to measure surface protein levels affected by interactions

    • Luciferase reporter assays to assess downstream signaling effects

  • Control experiments: Proper controls are critical, such as:

    • Negative control proteins (e.g., CD9, EPOR) that should not interact with LAPTM4B

    • Domain deletion or point mutation variants to map interaction interfaces

    • Competitive binding assays to confirm specificity

The successful identification of LAPTM4B-GARP interaction using complementary approaches (yeast two-hybrid followed by protein complementation assays) provides a methodological template for studying other LAPTM4B interactions .

How can CRISPR-Cas9 technology be utilized to study LAPTM4B function?

CRISPR-Cas9 technology offers powerful approaches for investigating LAPTM4B function at both cellular and organismal levels. Implementation strategies include:

  • Gene knockout studies:

    • Complete LAPTM4B knockout to assess loss-of-function phenotypes

    • Isoform-specific targeting by directing gRNAs to unique exon regions of specific isoforms

    • Conditional knockout systems (e.g., Cre-loxP combined with CRISPR) for tissue-specific or inducible deletion

    • Paired with TGF-β1 signaling reporters to directly measure functional consequences

  • Gene editing for structure-function analysis:

    • Introduction of point mutations in key domains (e.g., PY motifs implicated in lysosomal targeting)

    • Creation of domain deletion variants to map interaction surfaces

    • Insertion of epitope tags at endogenous loci for tracking native protein without overexpression artifacts

    • Modification of potential post-translational modification sites

  • Transcriptional modulation:

    • CRISPRi (CRISPR interference) for temporary, reversible repression of LAPTM4B expression

    • CRISPRa (CRISPR activation) to upregulate endogenous LAPTM4B, mimicking cancer-associated overexpression

    • Targeting of regulatory elements to understand transcriptional control mechanisms

  • Protein localization and trafficking studies:

    • Knock-in of fluorescent tags to track endogenous LAPTM4B trafficking

    • Disruption of specific trafficking motifs to assess compartment-specific functions

    • Combined with live-cell imaging to study dynamic localization patterns

  • High-throughput screens:

    • CRISPR screens to identify genes that modify LAPTM4B-dependent phenotypes

    • Combinatorial knockouts to map genetic interactions in the TGF-β pathway

    • Screens for modifiers of LAPTM4B-mediated immune suppression

Methodological considerations include:

  • Design of guide RNAs with minimal off-target effects

  • Validation of editing efficiency through sequencing and protein analysis

  • Use of appropriate cell types (e.g., regulatory T cells for immune function studies)

  • Inclusion of rescue experiments with wild-type or mutant LAPTM4B to confirm specificity

  • Comparing phenotypes in different species (human vs. macaque) to assess evolutionary conservation

These approaches can help clarify LAPTM4B's role in TGF-β1 regulation, immune function, and oncogenic pathways identified in previous studies .

What are the future research directions for understanding LAPTM4B biology?

The current understanding of LAPTM4B biology highlights several promising research directions:

  • Expanded mechanistic studies of TGF-β1 regulation: Future research should elucidate the detailed molecular mechanism by which LAPTM4B regulates GARP surface levels and TGF-β1 processing. This could involve structural studies of the LAPTM4B-GARP complex and identification of additional components in this regulatory pathway .

  • Comparative analysis across species: Detailed characterization of Macaca fascicularis LAPTM4B compared to human LAPTM4B would strengthen the translational value of non-human primate models in immunological and cancer research .

  • Connection between immune and cancer functions: Investigation of how LAPTM4B's dual roles in immune regulation and oncogenesis might be mechanistically linked. This could involve studying whether cancer cells exploit LAPTM4B's immunoregulatory functions to evade immune surveillance .

  • Therapeutic targeting strategies: Development of approaches to modulate LAPTM4B activity for potential applications in cancer treatment or immune regulation. This might include small molecule inhibitors of LAPTM4B-GARP interaction or antibodies targeting surface-exposed domains .

  • Systems biology approaches: Integration of LAPTM4B into broader protein-protein interaction networks related to lysosomal function, membrane trafficking, and immune regulation. Comparison with other lysosomal membrane proteins like TMBIM1 could reveal common principles in membrane protein trafficking and degradation pathways .

  • LAPTM4B in diverse immune cell types: Expanding studies beyond regulatory T cells to understand potential roles in other immune cell populations, particularly in the context of tumor microenvironments.

  • Role in multivesicular body formation: Investigation of whether LAPTM4B participates in ESCRT-dependent processes similar to those described for TMBIM1, potentially through interaction with components like TSG101 .

The emerging understanding of LAPTM4B as both an immune regulator and oncogene presents exciting opportunities for interdisciplinary research spanning immunology, cancer biology, and cell biology fields.

What are the key technical considerations for ensuring reproducibility in LAPTM4B research?

Ensuring reproducibility in LAPTM4B research requires attention to several critical factors:

  • Isoform specification and verification: Clearly document which LAPTM4B isoform(s) are being studied, as functional differences may exist between iso20 and iso24 variants . Verification should include:

    • Western blotting to confirm protein expression and size

    • Sequencing validation of expression constructs

    • Consideration of species-specific isoform variations

  • Expression level considerations: Overexpression systems may create artifacts. Researchers should:

    • Compare multiple expression levels when possible

    • Include appropriate empty vector controls

    • Consider complementary knockdown approaches

    • When feasible, study endogenous protein through knock-in strategies

  • Cell type selection: LAPTM4B function appears context-dependent:

    • Use of appropriate cell lines (e.g., regulatory T cells for immune studies, cancer cell lines for oncogenic function)

    • Consideration of species-specific differences when comparing results across human and non-human primate systems

    • Documentation of passage number and authentication data for cell lines

  • Interaction validation methodology: For protein-protein interaction studies:

    • Employ multiple complementary techniques (e.g., yeast two-hybrid, protein complementation assays, co-immunoprecipitation)

    • Include appropriate negative controls (non-interacting proteins)

    • Verify subcellular localization of interaction partners

  • Functional assay standardization:

    • For TGF-β1 production studies: standardize ELISA protocols and sampling timepoints

    • For trafficking studies: consistent imaging parameters and quantification methods

    • For degradation studies: standardized cycloheximide chase protocols with appropriate inhibitor controls (e.g., chloroquine, MG132)

  • Reagent validation and sharing:

    • Antibody validation for specificity against LAPTM4B vs. related family members

    • Public deposition of validated plasmids and reagents

    • Detailed documentation of recombinant protein production methods

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.