Recombinant Macaca fascicularis Mas-related G-protein coupled receptor member D (MRGPRD)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

MRGPRD belongs to the Mas-related G-protein coupled receptor (MRGPR) family, characterized by seven transmembrane domains and activation via ligands like β-alanine. The recombinant form for Macaca fascicularis includes:

PropertyDetail
UniProt IDQ6L786
Amino Acid Sequence1-320 residues: MNQTLNSSGTAELALNHSRGSVVHAACLVLSSLAMFTCLCGMAGNSMVI...
Protein NamesMas-related G-protein coupled receptor member D; Beta-alanine receptor
Gene SynonymsMRGD, G-protein coupled receptor TGR7

Recombinant variants are produced using E. coli, yeast, baculovirus, or mammalian cell systems, with tags (e.g., His-tag) for purification .

Role in Pain and Inflammation

  • MRGPRD activation by β-alanine inhibits KCNQ/M-type potassium channels, increasing dorsal root ganglion (DRG) neuron excitability .

  • In lipopolysaccharide (LPS)-induced inflammatory pain models, MRGPRD knockout mice show reduced mechanical and cold hypersensitivity, linked to suppressed NF-κB signaling .

  • MRGPRD interacts with TGF-β-activated kinase 1 (TAK1) and IKK complexes, amplifying pro-inflammatory cytokine production .

Neuro-Immune Modulation

  • MRGPRD-expressing neurons suppress mast cell hyperresponsiveness via glutamate release, mitigating skin inflammation .

  • Ablation of these neurons exacerbates mast cell degranulation in Staphylococcus aureus infection models .

Gastrointestinal Motility

  • Systemic β-alanine or alamandine (MRGPRD agonists) delays gastrointestinal transit in mice by attenuating intestinal contractions .

Species-Specific Expression Patterns

MRGPRD in Macaca fascicularis shows overlapping expression with MRGPRX1 in DRG neurons:

SpeciesMRGPRD+/MRGPRX1+ NeuronsTRPV1 Co-expression
Human89.6%95.2%
Macaque78.1%93.9%

This contrasts with rodents, where MRGPRD+ neurons are TRPV1-negative, highlighting primate-specific nociceptor biology .

Applications in Research

  • Drug Development: Targeted for analgesics due to its role in chronic pain pathways .

  • Immune Studies: Used to explore neuron-mast cell crosstalk in dermatitis and allergic responses .

  • Structural Biology: MRGPRD’s unique TM4-TM5 disulfide bond (absent in other GPCRs) aids studies on receptor activation mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MRGPRD; MRGD; Mas-related G-protein coupled receptor member D; Beta-alanine receptor; G-protein coupled receptor TGR7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-320
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
Target Protein Sequence
MNQTLNSSGTAELALNHSRGSVVHAACLVLSSLAMFTCLCGMAGNSMVIWLLGFRMRRTP FSIYILNLAAADLLFVFCMAAMLSLETQPLVSTTDKVHELMKRLKYFAYTVGLSLLTAIS TQRCLSVLFPIWFKCHRPRHLSAWVCALLWMLCLLTNGLTSCFCSKFLKFNKDQCFRVDM VQAALIMGVLTPVMTLSSLTLFVRVRRSSQQWRRQPTRLFVVVLASVLVFLICSLPLGFY WFVLYWLNLPPDTKVLYFNLSRLSSSMSSSANPLIYFLVGSRRSRRLQGSLGTVLQRALR EEPELEGGETPTTGTNEMGA
Uniprot No.

Target Background

Function
May regulate nociceptor function and/or development, including pain sensation and modulation. It acts as a specific membrane receptor for beta-alanine, coupling with G-proteins G(q) and G(i).
Protein Families
G-protein coupled receptor 1 family, Mas subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Co-expressed in the small diameter neurons with P2X3 and VR1 in dorsal root ganglia.

Q&A

What is Recombinant Macaca fascicularis MRGPRD?

Recombinant Macaca fascicularis MRGPRD is a laboratory-produced G-protein coupled receptor protein derived from the crab-eating macaque (cynomolgus monkey). It consists of 320 amino acids and belongs to the Mas-related G-protein coupled receptor family. The recombinant protein typically includes the full-length protein sequence (residues 1-320) and may contain various tags determined during the production process .

What are the known ligands for MRGPRD?

MRGPRD is stimulated by several key ligands:

  • Ala¹-Ang-(1-7), also known as alamandine - a decarboxylated form of Ang-(1-7)

  • Ang-(1-7) - though with lower affinity than alamandine

  • Beta-alanine - acting as an agonist for MRGPRD

These ligands activate the receptor through different mechanisms, with alamandine showing the highest specificity for MRGPRD. While alamandine primarily acts through MRGPRD, it can also interact with the Mas receptor, demonstrating overlapping functionality with Ang-(1-7) .

How is MRGPRD distributed in the central nervous system?

MRGPRD shows a distinct expression pattern in the mouse brain, with region-specific distribution. Studies using transgenic mouse models with MRGPRD expression markers reveal:

Brain RegionMRGPRD ExpressionRelative Intensity
CortexPresentModerate
HippocampusPresentModerate to high
AmygdalaPresentHigh
HypothalamusPresentModerate
Habenular nucleiPresentModerate
StriatumPresentModerate
PallidumPresentModerate
Midbrain nucleiPresentVariable
Periaqueductal grayPresent (small population)Low

This distribution pattern, particularly in reward- and limbic-related areas, suggests MRGPRD's involvement in pain perception/modulation, synaptic plasticity, learning, memory, and cognition .

What methods are most effective for detecting MRGPRD expression in tissue samples?

Due to the lack of specific antibodies against MRGPRD, alternative approaches are necessary:

  • Genetic Reporter Models: The most reliable method uses transgenic mouse lines where MRGPRD-expressing cells are marked with fluorescent proteins. For example, MrgD^IRES-EGFPf mice maintain intact MRGPRD coding sequences followed by an internal ribosomal entry site (IRES) and enhanced green fluorescent protein (EGFPf) cassette .

  • Immunohistochemistry Enhancement Protocol:

    • Use 30 μm coronal sections mounted on superfrost slides

    • Enhance weak GFP signals with specific anti-GFP antibodies (1:200, rabbit)

    • Visualize using goat anti-rabbit secondary antibody labeled with Cy3 (1:2000)

    • Counterstain with DAPI to visualize cell nuclei

    • Cover-slip with Mowiol

  • Quantification Method:

    • Calculate corrected total cell fluorescence (CTCF)

    • Measure both green (direct GFP) and red (antibody-enhanced) fluorescence

    • Adjust for background intensity

  • Single-cell RNA Sequencing: This technique allows identification of MRGPRD expression at the transcriptional level and can reveal differential expression patterns in various pathological conditions .

How does MRGPRD contribute to nociception?

MRGPRD plays a crucial role in mechanical nociception through several mechanisms:

  • Sensory Neuron Excitability: MRGPRD functions as an excitatory G-protein coupled receptor that directly influences dorsal root ganglion (DRG) neuron excitability in response to mechanical stimuli .

  • Cutaneous Afferent Targeting: MRGPRD is expressed exclusively by a nociceptive neuronal population that extends into the outermost layer of the skin, making it strategically positioned for detecting mechanical stimuli .

  • Calcium Signaling Regulation: Activation of MRGPRD-positive cutaneous afferents results in increased intracellular calcium influx into DRG nociceptors, which serves as a readout of nociceptor hyperexcitability .

  • Mechanical Allodynia Mediation: In models of painful diabetic neuropathy (PDN), limiting MRGPRD signaling reversed mechanical allodynia, demonstrating its direct involvement in pathological pain states .

  • Species Conservation: MRGPRD's role in mechanical nociception is well-established both in mice and humans, indicating evolutionary conservation of this pain pathway .

What is the relationship between MRGPRD and the renin-angiotensin system (RAS)?

MRGPRD is an integral component of the beneficial arm of the renin-angiotensin system in the central nervous system:

  • MRGPRD belongs to the "protective axis" of RAS alongside the ACE2/Ang-(1-7)/Mas receptor signaling pathway, which is highly expressed throughout the brain and has neuroprotective properties .

  • MRGPRD can be activated by Ala¹-Ang-(1-7) (alamandine), a decarboxylated form of Ang-(1-7), as well as by Ang-(1-7) itself, albeit with different affinities .

  • While Mas receptors influence neuronal activity, synaptic plasticity, learning, and memory, the Ala¹-Ang-(1-7)/Ang-(1-7)/MRGPRD axis's specific role in the nervous system remains less characterized .

  • The positioning of MRGPRD within the RAS suggests potential roles beyond pain processing, possibly extending to neuroplasticity and neuroprotection in various CNS functions .

What are optimal approaches for studying MRGPRD function in animal models?

Several specialized techniques have proven effective for MRGPRD research:

  • Genetic Reporter Mouse Models:

    • MrgD^IRES-EGFPf transgenic mice maintain intact MRGPRD coding while marking expressing cells with green fluorescence

    • These models allow visualization of MRGPRD-positive cells without relying on antibodies

    • Control experiments should include wild-type littermates to account for background fluorescence

  • Single-cell RNA Sequencing:

    • Enables comprehensive gene expression profiling of DRG neurons

    • Can identify differential expression of MRGPRD in specific subpopulations

    • Particularly valuable for comparing healthy versus pathological states

    • Should include computational analysis to identify distinct neuronal clusters

  • In Vivo Calcium Imaging:

    • Allows real-time assessment of MRGPRD-positive neuron activity

    • Provides a direct readout of neuronal excitability in response to stimuli

    • Can demonstrate how MRGPRD activation influences calcium influx in nociceptors

  • High-Fat Diet Mouse Model of Painful Diabetic Neuropathy:

    • Well-established model for studying MRGPRD's role in neuropathic pain

    • Enables assessment of mechanical allodynia in relation to MRGPRD function

    • Should include both behavioral testing and molecular analysis

How can researchers validate the specificity of MRGPRD targeting in experiments?

Validating MRGPRD specificity requires multiple complementary approaches:

  • Genetic Validation:

    • Use MRGPRD knockout models as negative controls

    • Compare with heterozygous and wild-type animals to establish dosage effects

    • Employ conditional knockout strategies to target specific tissues or developmental stages

  • Pharmacological Validation:

    • Test multiple MRGPRD ligands with varying affinities

    • Include known antagonists as blocking controls

    • Compare responses to structurally similar but non-binding compounds

  • Expression Verification:

    • Combine reporter gene visualization with in situ hybridization

    • Quantify both protein expression (where possible) and mRNA transcripts

    • Use FISH (fluorescent in situ hybridization) to count Mrgprd+ dots per cell and measure average intensity of expression

  • Functional Confirmation:

    • Demonstrate reversal of effects with MRGPRD antagonists

    • Show corresponding changes in downstream signaling pathways

    • Correlate expression levels with functional readouts (e.g., calcium influx, action potential generation)

How does MRGPRD contribute to neuroplasticity in pain conditions?

MRGPRD plays a significant role in neuroplastic changes associated with chronic pain conditions:

  • Expression Upregulation: In models of painful diabetic neuropathy (PDN), MRGPRD expression increases specifically in a subpopulation of DRG neurons, representing a neuroplastic adaptation to diabetic conditions .

  • Reward Circuit Involvement: MRGPRD-positive cells are found in cortical and subcortical elements of the brain's reward circuitry, including the nucleus accumbens, hippocampus, and amygdala. These regions play crucial roles in pain perception, modulation, and the transition from acute to chronic pain .

  • Neurotransmitter System Interaction: The reward neural circuits involving MRGPRD interact with GABA, glutamate, and dopamine neurotransmission, suggesting complex neuroplastic mechanisms beyond simple nociception .

  • Persistent Hyperexcitability: Activation of MRGPRD-positive cutaneous afferents in diabetic conditions leads to sustained increases in intracellular calcium influx in DRG nociceptors, indicating persistent neuroplastic changes in sensory processing .

  • Synaptic Plasticity: The localization of MRGPRD in areas associated with synaptic plasticity, learning, and memory suggests its involvement in experience-dependent neural adaptations that may contribute to chronic pain states .

What are the key considerations when designing MRGPRD-targeted therapeutics?

Developing therapeutics targeting MRGPRD requires attention to several critical factors:

  • Receptor Specificity: While MRGPRD is a "highly druggable" target, compounds must be screened for specificity against related receptors, including other Mrg family members and the Mas receptor, which shares some ligands with MRGPRD .

  • Tissue Distribution Considerations: MRGPRD expression in both peripheral sensory neurons and specific brain regions means potential therapeutics may have both peripheral and central effects that need to be characterized .

  • Pathway Selectivity: Since MRGPRD activates multiple downstream signaling pathways, compounds should be assessed for pathway-biased activity to optimize therapeutic effects while minimizing side effects.

  • Disease-Specific Targeting: As MRGPRD expression changes in pathological conditions like PDN, therapeutic approaches might need to account for altered receptor levels or distribution in disease states .

  • Translational Relevance: While MRGPRD's role in mechanical nociception is established in both mice and humans, species differences in receptor pharmacology must be addressed during therapeutic development .

How should researchers analyze calcium imaging data from MRGPRD-positive neurons?

Calcium imaging of MRGPRD-positive neurons requires specialized analytical approaches:

  • Signal Normalization Protocol:

    • Calculate baseline fluorescence (F₀) before stimulus application

    • Express changes as ΔF/F₀ to account for variations in indicator loading

    • Apply rolling average to reduce noise while preserving temporal resolution

    • Consider photobleaching correction for extended imaging sessions

  • Response Quantification Parameters:

    • Peak amplitude (maximum ΔF/F₀)

    • Area under curve (total calcium response)

    • Time to peak (kinetics of response)

    • Duration at half-maximum (response sustainability)

    • Response threshold (minimum stimulus producing detectable signal)

  • Population Analysis Considerations:

    • Categorize responses as "responders" versus "non-responders" using objective criteria

    • Analyze response heterogeneity within MRGPRD-positive populations

    • Compare with other neuronal subtypes using appropriate statistical tests

    • Correlate calcium responses with electrophysiological or behavioral measures

What are the current limitations in MRGPRD research methodologies?

Several methodological challenges persist in MRGPRD research:

  • Antibody Limitations: Specific antibodies against MRGPRD are lacking, necessitating indirect detection methods such as genetic reporter models. This limits protein-level studies in non-genetically modified systems, particularly in human samples .

  • Functional Redundancy: MRGPRD shares ligand sensitivity with the Mas receptor, making it difficult to isolate MRGPRD-specific effects in systems where both receptors are expressed .

  • Translational Gaps: While MRGPRD homologs exist across species, the full Mrg receptor family shows significant species differences, complicating translation between rodent models and humans .

  • Technical Challenges in CNS Studies: The relatively sparse distribution of MRGPRD-positive cells in some brain regions makes detection challenging, requiring specialized techniques and careful background control .

  • Methodological Standardization: Current literature shows variability in methods for measuring MRGPRD expression and function, making cross-study comparisons difficult. Standardized protocols for quantification are needed, particularly for intensity measurements of fluorescent reporters .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.