Recombinant Macaca fascicularis Melanocortin receptor 4 (MC4R)

Shipped with Ice Packs
In Stock

Description

Production and Expression Systems

Recombinant MC4R is synthesized using bacterial or mammalian systems to ensure proper folding and functionality:

  • Bacterial Expression: E. coli systems produce His-tagged MC4R for affinity purification .

  • Mammalian Systems: HEK293 or CHO cells may be used for post-translational modifications .

Table 2: MC4R Mutations and Obesity in Macaques

Mutation TypePhenotype AssociationFrequencySource
Non-synonymousObesity-specific (5/13)38.5%
SynonymousNeutral61.5%

Drug Development

Recombinant MC4R is used to screen agonists/antagonists:

  • Agonist Testing: MC4R binds α-MSH and synthetic ligands (e.g., setmelanotide), activating Gs-protein signaling and cAMP production .

  • Pharmacological Chaperones: Compounds like ML00253772 rescue misfolded MC4R mutants, restoring membrane localization .

Evolutionary and Comparative Insights

  • Primate Evolution: MC4R exhibits stricter evolutionary constraints in humans than in chimpanzees, reflecting its critical role in energy homeostasis .

  • Species-Specific Models: Macaca fascicularis serves as a translational model for studying human obesity due to shared genetic and physiological pathways .

Challenges and Future Directions

  • Receptor Trafficking: Mutations disrupting membrane localization remain a hurdle for therapeutic targeting .

  • Structural Studies: No crystal structures are available for macaque MC4R, limiting insights into ligand-binding mechanisms .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MC4R; QccE-10642; Melanocortin receptor 4; MC4-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-332
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
Target Protein Sequence
MVNSTHRGMHASLHLWNRSSHRLHSNASESLGKGYSDGGCYEQLFVSPEVFVTLGVISLL ENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDTQSFTVN IDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVKRVRIIISCIWAACTVS GILFIIYSDSSAVIICLITMFFTMLALMASLYVHMFLMARLHIKRIAVLPGTGAIRQGAN MKGAITLTILIGVFVVCWAPFFLHLIFYISCPQNPYCVCFMSHFNLYLILIMCNSVIDPL IYALRSQELRKTFKEIICCYPLGGLCDLSSRY
Uniprot No.

Target Background

Function
This receptor exhibits specificity for the heptapeptide core common to adrenocorticotropic hormone and alpha-, beta-, and gamma-MSH. It plays a central role in energy homeostasis and somatic growth. This receptor is mediated by G proteins that stimulate adenylate cyclase (cAMP).
Database Links

KEGG: mcf:102119180

UniGene: Mfa.8697

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What are the main signaling pathways associated with MC4R and how are they studied?

    MC4R signaling involves multiple pathways:

    • G protein-dependent pathways: MC4R couples to three main heterotrimeric G proteins:

      • Gs (stimulatory): Activates adenylyl cyclase leading to cAMP production and protein kinase A (PKA) activation

      • Gi (inhibitory): Inhibits adenylyl cyclase

      • Gq: Stimulates phospholipase C (PLC), leading to PIP2 hydrolysis into DAG and IP3

    • G protein-independent pathways: Including β-arrestin recruitment and activation of mitogen-activated protein kinase (MAPK) pathways leading to ERK1/2 and JNK phosphorylation

    These pathways are typically studied using:

    • cAMP accumulation assays (for Gs signaling)

    • Membrane potential assays with modified cyclic nucleotide gated channels

    • ERK1/2 phosphorylation assays

    • β-arrestin recruitment assays

    • Calcium mobilization assays (for Gq signaling)

  • How are MC4R variants classified and what is their significance in research?

    MC4R variants are typically classified based on their functional effects:

    1. Loss-of-function (LOF) variants: Reduce receptor function through various mechanisms:

      • Impaired trafficking to cell membrane

      • Decreased ligand binding

      • Reduced G-protein coupling

      • Altered signaling capacity

    2. Gain-of-function (GoF) variants: Enhance receptor activity, often showing biased signaling

    3. Wild-type-like variants: Function similar to the canonical receptor

    The significance of these variants extends beyond obesity research. Studies have shown associations with:

    • Type 2 diabetes risk

    • Coronary artery disease

    • Cancer susceptibility

    • Growth and development patterns

    Particularly interesting are GoF variants that exhibit signaling bias toward β-arrestin recruitment, which are associated with lower BMI and reduced risk of obesity-related diseases .

Advanced Research Methodologies

  • What techniques are used to evaluate the functional consequences of MC4R variants?

    Multiple complementary approaches are used to characterize MC4R variants:

    • cAMP accumulation assays: Measure Gs-mediated signaling using:

      • ELISA-based detection methods

      • Fluorescent or luminescent cAMP biosensors

      • Membrane potential assays with modified CNG channels

    • Cell surface expression assays:

      • Cell surface biotinylation followed by Western blotting

      • Flow cytometry with antibodies against N-terminal tags (e.g., HA-tag)

      • Immunofluorescence microscopy

    • Ligand binding assays:

      • Radioligand binding assays with labeled ligands

      • Competition binding assays

    • Signaling pathway analysis:

      • Western blotting for phosphorylated ERK1/2, PKA substrates, and CREB

      • MAPK pathway activation assays

      • β-arrestin recruitment assays using bioluminescence resonance energy transfer (BRET)

    A comprehensive analysis typically includes multiple assays to fully characterize variant effects on different signaling pathways.

  • How does deep mutational scanning contribute to understanding MC4R function?

    Deep mutational scanning (DMS) is a powerful technique that has been applied to MC4R to systematically evaluate the functional consequences of thousands of variants simultaneously. Recent DMS studies on MC4R have:

    1. Captured over 99% of possible MC4R variants with robust signals

    2. Investigated subtle functionalities such as:

      • Pathway-specific activities (G-protein vs. β-arrestin)

      • Differential responses to various ligands (α-MSH vs. synthetic agonists)

      • Structure-function relationships at high resolution

    3. Validated findings using clinical data from ClinVar and previous studies

    4. Provided insights for personalized drug therapy approaches

    DMS results can predict clinical phenotypes associated with variants and inform drug development strategies, particularly for pathway-selective or biased agonists .

  • What are the methodological approaches to studying biased signaling in MC4R?

    Biased signaling (preferential activation of one pathway over others) is particularly important for MC4R research and drug development. Methods to study this include:

    1. Comparative pathway analysis: Simultaneously measuring multiple signaling outputs:

      • G-protein signaling (cAMP accumulation)

      • β-arrestin recruitment

      • ERK1/2 phosphorylation

      • Gene expression changes

    2. Bias quantification:

      • Calculation of bias factors using concentration-response curves

      • Normalization to reference ligands

      • Statistical comparison of EC50 and Emax values across pathways

    3. Molecular dynamics simulations:

      • In silico analysis of receptor conformational changes

      • Prediction of ligand-specific receptor states

    Recent studies have shown that β-arrestin recruitment efficacy, rather than canonical Gαs-mediated cAMP production, explained 88% of the variance in MC4R variants' association with BMI , highlighting the importance of measuring multiple signaling pathways.

Experimental Design Questions

  • What are the optimal conditions for expressing recombinant Macaca fascicularis MC4R in cellular systems?

    For optimal expression and functional analysis of recombinant Macaca fascicularis MC4R:

    1. Expression systems:

      • HEK293 cells are commonly used (particularly HEK-293-CNG cells for cAMP assays)

      • GT1-7 hypothalamic neuronal cells for more physiologically relevant contexts

    2. Expression vectors:

      • pCMV-based vectors show good expression efficiency

      • Addition of N-terminal epitope tags (HA, FLAG) facilitates detection without interfering with function

    3. Transfection conditions:

      • Lipofection (e.g., Lipofectamine 2000) with 3 μg plasmid DNA for 10-cm dishes

      • Transfection at 75-80% cell confluency

      • Functional assays performed 24-48 hours post-transfection

    4. Storage conditions for recombinant protein:

      • Store at -20°C in Tris-based buffer with 50% glycerol

      • For extended storage, conserve at -80°C

      • Avoid repeated freeze-thaw cycles

      • Working aliquots can be stored at 4°C for up to one week

  • What are the critical controls required for MC4R functional assays?

    Rigorous controls are essential for reliable MC4R functional characterization:

    1. Positive controls:

      • Wild-type MC4R expression (same species as variant being tested)

      • Known fully functional variants (e.g., V103I for human MC4R)

      • Positive control agonists (α-MSH, NDP-α-MSH)

    2. Negative controls:

      • Empty vector transfection

      • Known non-functional variants (e.g., frameshift mutations)

      • Unstimulated cells for signaling assays

    3. Assay-specific controls:

      • Dose-response curves with reference agonists (NDP-α-MSH, setmelanotide)

      • Multiple time points for signaling pathway activation

      • Vehicle controls for all treatments

    4. Expression controls:

      • Total protein expression verification

      • Cell surface expression quantification

      • Normalization to housekeeping genes/proteins

    Proper controls allow reliable comparison between different MC4R variants and between experiments performed at different times.

  • How can MC4R signaling assays be optimized for detecting subtle functional differences between variants?

    To detect subtle differences in MC4R variant function:

    1. High-resolution dose-response curves:

      • Use wide concentration ranges of agonists (typically 10^-12 to 10^-6 M)

      • Include multiple intermediate concentrations for accurate EC50 determination

      • Calculate both EC50 and Emax values for comprehensive characterization

    2. Multiple time points:

      • Measure both acute (minutes) and sustained (hours) signaling responses

      • Capture potential differences in signal duration or desensitization

    3. Pathway-specific optimizations:

      • For cAMP assays: Pretreat cells with phosphodiesterase inhibitors

      • For MAPK pathway: Test multiple timepoints (5-60 minutes) to capture peak activation

      • For β-arrestin recruitment: Use real-time kinetic assays

    4. Statistical considerations:

      • Perform experiments in triplicate (minimum)

      • Use appropriate statistical tests for EC50 comparisons

      • Consider area-under-curve analyses for complete response profiles

    These optimizations are particularly important when characterizing variants with partial loss or gain of function.

Data Analysis and Interpretation

  • How can I reconcile contradictory functional data from different MC4R assays?

    Contradictory results between different assays are common in MC4R research and require careful interpretation:

    1. Pathway-specific effects:

      • Variants may affect different signaling pathways differently

      • Some variants show biased signaling (e.g., normal cAMP but reduced ERK activation)

      • Consider the physiological relevance of each pathway for the phenotype studied

    2. Methodological differences:

      • Cell type-specific effects (HEK293 vs. neuronal cells)

      • Assay sensitivity differences

      • Ligand-specific effects (α-MSH vs. NDP-α-MSH vs. setmelanotide)

    3. Reconciliation strategies:

      • Perform multiple complementary assays in the same experimental system

      • Compare variant effects across pathways using bias factors

      • Consider the relationship between in vitro findings and clinical phenotypes

      • Meta-analysis approaches when integrating data from different studies

    For example, in a large eMERGE network study, comprehensive analysis of MC4R variants required integration of sequencing data, functional assays, and clinical phenotypes to resolve contradictory findings about variant effects .

  • What statistical approaches are recommended for analyzing MC4R variant functional data?

    Robust statistical approaches for MC4R variant analysis include:

    1. For single variant characterization:

      • Compare EC50 and Emax values to wild-type using appropriate statistical tests

      • Use non-linear regression for dose-response curves

      • Apply Bonferroni or FDR correction for multiple comparisons

    2. For population studies:

      • Linear regression for continuous traits (BMI, response to agonists)

      • Logistic regression for binary outcomes (obesity status)

      • Adjust for covariates: age, sex, ancestry, and experimental site

    3. For rare variant analysis:

      • Burden tests (e.g., SKAT-O) to aggregate effects of rare variants

      • Threshold criteria: include variants with MAF < 0.1% and present in ≥2 individuals

      • Filter for relevant phenotypes using minimum case numbers (e.g., ≥20 cases)

    4. For integrating functional and clinical data:

      • Meta-regression using functional consequences as predictors

      • Penetrance estimation for variants of interest

      • PheWAS approaches to identify novel phenotype associations

    In a large eMERGE study, researchers successfully used these approaches to identify that β-arrestin recruitment efficacy explained 88% of the variance in BMI association .

  • How should phenotype data be collected and analyzed when studying MC4R variants?

    Comprehensive phenotyping for MC4R variant studies should include:

    1. Anthropometric measurements:

      • BMI calculated from accurate height and weight measurements

      • For pediatric subjects: BMI-for-age percentiles using CDC guidelines

      • Longitudinal measurements when available (median and maximum BMI)

      • Waist circumference and body composition when possible

    2. Quality control for phenotype data:

      • Screen for data entry errors (e.g., implausible BMI values >100 kg/m²)

      • Exclude temporary conditions affecting weight (pregnancy, edema)

      • For longitudinal data, calculate mean and median values

      • Document age at measurements

    3. Associated phenotypes:

      • Metabolic parameters (insulin, glucose, lipid profiles)

      • Food intake and eating behavior assessments

      • Growth patterns and height velocity in children

      • Presence of hyperphagia and early-onset obesity

    4. Analysis approaches:

      • For quantitative traits: use median BMI for common variant analyses

      • For penetrance estimation: use highest post-QC BMI value

      • For pediatric subjects: use age and sex-adjusted percentiles

      • Consider family history and inheritance patterns

    Phenotype CategoryMeasurementsData ProcessingAnalysis Approach
    AnthropometricHeight, weight, BMI, waist circumferenceCalculate mean/median, screen for errorsLinear regression adjusted for age, sex, ancestry
    Metabolic parametersGlucose, insulin, lipids, blood pressureStandard clinical cutoffsCompare to reference ranges, regression analysis
    BehavioralEating patterns, food intake, hunger scoresValidated questionnairesCompare to non-carrier controls
    Development (pediatric)Growth velocity, pubertal timingAge-adjusted z-scoresLongitudinal analysis
  • What are the current challenges in interpreting novel MC4R variants?

    Key challenges in MC4R variant interpretation include:

    1. Functional classification uncertainty:

      • Variants may show partial or context-dependent effects

      • Different functional assays may yield contradictory results

      • Limited data on long-term physiological impacts

    2. Population-specific considerations:

      • Variant frequencies differ significantly across ancestral groups

      • Most functional studies focus on variants found in European populations

      • Limited data on variants in underrepresented populations

    3. Genotype-phenotype correlation challenges:

      • Incomplete penetrance of obesity phenotypes

      • Variable expressivity even within families

      • Influence of environmental factors on phenotypic expression

    4. Methodological limitations:

      • In vitro assays may not fully recapitulate in vivo function

      • Limited availability of standardized functional assays

      • Challenges in interpreting variants affecting multiple signaling pathways

    5. Therapeutic implications:

      • Predicting response to MC4R-targeted therapies

      • Determining which signaling pathway is most relevant for treatment

      • Personalizing treatments based on specific variant functional properties

    Addressing these challenges requires integration of multiple approaches, including deep mutational scanning, comprehensive signaling pathway analysis, and correlation with clinical outcomes.

Translational Research Applications

  • How can MC4R functional data inform therapeutic approaches for obesity?

    Functional characterization of MC4R variants provides crucial insights for therapeutic development:

    1. Mechanism-based drug development:

      • Biased agonists targeting specific beneficial signaling pathways

      • Compounds that rescue cell surface expression of trafficking-deficient variants

      • Allosteric modulators that enhance receptor sensitivity

    2. Patient stratification:

      • Individuals with specific MC4R variants may respond differently to treatments

      • GoF variants associated with β-arrestin recruitment suggest potential therapeutic targets

      • LOF variants affecting different mechanisms may require different therapeutic approaches

    3. Precision medicine applications:

      • Setmelanotide (MC4R agonist) shows efficacy in specific genetic forms of obesity

      • Variant-specific responses to different MC4R agonists

      • Potential for developing variant-specific treatment approaches

    Recent studies have shown that MC4R variants with biased signaling toward β-arrestin recruitment are associated with lower BMI and protection from obesity, diabetes, and cardiovascular disease, suggesting that developing β-arrestin-biased MC4R agonists may be a promising therapeutic strategy .

  • What is the relevance of Macaca fascicularis MC4R for translational obesity research?

    Macaca fascicularis (cynomolgus monkey) MC4R is particularly valuable in translational research for several reasons:

    1. Phylogenetic proximity to humans:

      • High sequence homology with human MC4R

      • Similar physiological responses to MC4R activation

      • Comparable metabolic regulation systems

    2. Preclinical model advantages:

      • More predictive of human responses than rodent models

      • Similar eating behaviors and energy homeostasis mechanisms

      • Comparable pharmacokinetic and pharmacodynamic profiles for obesity drugs

    3. Research applications:

      • Testing MC4R-targeted therapeutics before human trials

      • Studying long-term effects of MC4R modulation

      • Investigating complex phenotypes associated with MC4R function

      • Evaluating drug safety profiles in a physiologically relevant system

    4. Technical considerations:

      • Expression systems for recombinant Macaca fascicularis MC4R are well-established

      • Functional assays developed for human MC4R can be adapted with minimal modifications

      • Comparative studies between human and macaque MC4R provide evolutionary insights

    Studies utilizing recombinant Macaca fascicularis MC4R can bridge the gap between basic molecular research and human clinical applications, particularly for novel obesity therapeutics targeting the melanocortin system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.