Recombinant Macaca fascicularis Metallophosphoesterase 1 (MPPE1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MPPE1; PGAP5; QccE-17977; QtsA-17896; Metallophosphoesterase 1; Post-GPI attachment to proteins factor 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-396
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
MPPE1
Target Protein Sequence
MAMIEVGFERQNFYPLKRKSALLLKLIAVVFAVLLFCEFLIYYLAIFQCNWPEVKTTAYD GEQASHEPVLKAMFLADTHLLGEFLGHWLDKLRREWQMERALQTALWLLQPEVVFILGDV FDEGKWSTPEAWADDVERFQKMFRHPSHVQLKVVAGNHDIGFHYEMNTYKVERFEKVFSS ERLFSWKGINFVMVNSVAMNGDGCGICSEAEAELIEVSHRLNCSREARGSRRCGPGPLLP VSAPVLLQHYPLYRRSDANCSGDDAAPPEERDIPFKENYDVLSREASQKLLWWLQPRLVL SGHTHSACEVHHGGRVPEFSVPSFSWRNRNNPSFIMGSITPTDYALSKCYLPREDVVLVI YCGAVGFLVVLTLSHLGLLASPFLSGLNLLRKRKTR
Uniprot No.

Target Background

Function
Metallophosphoesterase 1 (MPPE1) is essential for the transport of glycosylphosphatidylinositol (GPI)-anchored proteins from the endoplasmic reticulum to the Golgi apparatus. It plays a critical role in GPI-anchor lipid remodeling by removing an ethanolamine-phosphate (EtNP) side chain from the second mannose (Man2) residue of the GPI intermediate. This enzymatic activity is crucial for the efficient transport of GPI-anchored proteins.
Database Links

KEGG: mcf:102138710

UniGene: Mfa.1486

Protein Families
Metallophosphoesterase superfamily, MPPE1 family
Subcellular Location
Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein.

Q&A

What is Metallophosphoesterase 1 (MPPE1) and what is its function in Macaca fascicularis?

MPPE1 in Macaca fascicularis (cynomolgus monkey) is a 396-amino acid protein with a molecular weight of approximately 45.3 kDa. Functionally, it serves as a metallophosphoesterase required for the transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi apparatus. The protein acts in lipid remodeling steps of GPI-anchor maturation by mediating the removal of a side-chain ethanolamine-phosphate (EtNP) from the second mannose (Man2) of the GPI intermediate, which is an essential step for efficient transport of GPI-anchor proteins .

Methodological approach for characterizing MPPE1 function:

  • Subcellular localization studies using fluorescently tagged MPPE1

  • Enzymatic activity assays measuring phosphoesterase activity on GPI-anchored substrates

  • Comparative analysis of GPI-anchor protein trafficking in cells with normal vs. knocked-down MPPE1 expression

What protein family does MPPE1 belong to and what are its key structural characteristics?

MPPE1 belongs to the metallophosphoesterase superfamily, specifically the MPPE1 family . This classification reflects its enzymatic function in hydrolyzing phosphoester bonds. The protein structure has several key characteristics:

Key structural features of Macaca fascicularis MPPE1:

  • Contains transmembrane domains that anchor it in the ER/Golgi membrane

  • Features a catalytic domain with conserved metal-binding residues

  • Includes regions for substrate recognition specifically for GPI-anchor intermediates

Structural analysis methods:

  • X-ray crystallography or cryo-EM for 3D structure determination

  • Bioinformatic analysis using homology modeling based on related metallophosphoesterases

  • Circular dichroism spectroscopy to assess secondary structure components

What is the role of MPPE1 in GPI-anchor protein transport?

MPPE1 plays a critical role in GPI-anchor protein transport by facilitating a key remodeling step. Specifically, it mediates the removal of a side-chain ethanolamine-phosphate (EtNP) from the second mannose (Man2) of the GPI intermediate, which is essential for efficient transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi apparatus .

Methodology for studying MPPE1's role in transport:

  • Pulse-chase experiments with radioactively labeled GPI-anchor precursors

  • Immunofluorescence microscopy to track GPI-anchored protein trafficking

  • Cell fractionation to isolate and analyze ER and Golgi compartments

  • Mass spectrometry analysis of GPI-anchor structures in MPPE1-deficient vs. normal cells

What are the best experimental models for studying MPPE1 function?

Recommended experimental models:

  • Cell culture systems:

    • Cynomolgus monkey cell lines (closest to native environment)

    • Human cell lines for comparative studies

    • MPPE1 knockout cell lines created using CRISPR-Cas9

  • Recombinant protein systems:

    • Purified recombinant MPPE1 for in vitro enzymatic assays

    • Reconstituted membrane systems with GPI-anchor substrates

  • Animal models:

    • Cynomolgus macaques provide the most relevant in vivo system

    • Mauritian cynomolgus macaques (MCMs) offer advantages due to their restricted genetic diversity

    • Transgenic mouse models with MPPE1 modifications

Methodological considerations:

  • Selection criteria should include protein expression levels, post-translational modifications, and availability of reagents

  • Validation of model systems through comparative functional assays

  • Ethical considerations for primate research following the global "3R" animal welfare initiative (reduce, refine, replace)

What methods can be used to express and purify recombinant Macaca fascicularis MPPE1 for functional studies?

Expression systems:

  • Mammalian expression systems:

    • HEK293 or CHO cells for mammalian post-translational modifications

    • Cynomolgus-derived cell lines for native processing

    • Inducible expression systems for controlling expression levels

  • Insect cell expression:

    • Baculovirus expression system for higher yields with eukaryotic processing

    • Optimized vectors containing secretion signals and affinity tags

  • Bacterial expression (for domains lacking transmembrane regions):

    • E. coli systems with solubility-enhancing fusion partners

    • Cell-free protein synthesis for challenging constructs

Purification strategies:

  • Membrane protein extraction protocols:

    • Detergent screening for optimal solubilization (n-dodecyl-β-D-maltoside, digitonin)

    • Lipid nanodiscs or amphipols for maintaining native conformation

  • Chromatography sequence:

    • Immobilized metal affinity chromatography (IMAC) using histidine tags

    • Size exclusion chromatography for final polishing

    • Ion exchange chromatography for removing contaminants

  • Quality control methods:

    • Enzymatic activity assays to confirm functional state

    • Circular dichroism to verify proper folding

    • Mass spectrometry for protein integrity verification

How can researchers effectively design experiments to study the enzymatic activity of MPPE1?

Enzymatic activity assay design:

  • Substrate preparation:

    • Synthetic GPI-anchor analogues with fluorescent or radioactive labels

    • Natural GPI-anchored substrates isolated from cells

    • Mass spectrometry-compatible substrates for reaction monitoring

  • Reaction conditions optimization:

    • Metal ion dependency determination (testing various divalent cations)

    • pH and buffer composition screening

    • Temperature and time course analyses

  • Activity measurement approaches:

    • Fluorescence-based assays for high-throughput screening

    • HPLC or LC-MS/MS for detailed product analysis

    • Radiometric assays for high sensitivity

Experimental validation strategy:

  • Site-directed mutagenesis of catalytic residues as negative controls

  • Comparison with known metallophosphoesterases

  • Inhibitor studies to confirm specificity

What are the challenges in characterizing the metallophosphoesterase activity of MPPE1?

Common challenges and solutions:

  • Membrane protein solubility issues:

    • Challenge: Maintaining enzymatic activity after extraction from membranes

    • Solution: Screen multiple detergents or use membrane mimetics like nanodiscs

    • Methodology: Systematic detergent screening with activity assays

  • Metal cofactor requirements:

    • Challenge: Identifying the physiologically relevant metal ions

    • Solution: Activity assays with different metal ions (Mg²⁺, Mn²⁺, Zn²⁺, etc.)

    • Methodology: ICP-MS analysis of purified active enzyme

  • Substrate specificity determination:

    • Challenge: Limited availability of natural GPI-anchor substrates

    • Solution: Development of synthetic substrate analogues

    • Methodology: Comparative kinetic analysis with multiple substrate variants

  • Assay sensitivity and specificity:

    • Challenge: Distinguishing MPPE1 activity from other phosphoesterases

    • Solution: Use of specific inhibitors and knockout controls

    • Methodology: Parallel reaction monitoring with mass spectrometry

How can researchers investigate the interaction between MPPE1 and GPI-anchored proteins?

Methods for studying protein-protein interactions:

  • Co-immunoprecipitation approaches:

    • Antibody-based pull-down of MPPE1 followed by analysis of interacting partners

    • Reverse co-IP using GPI-anchored proteins as bait

    • Mass spectrometry identification of interaction partners

  • Proximity labeling techniques:

    • BioID or TurboID fusions with MPPE1 to identify proximal proteins

    • APEX2-based proximity labeling in the ER/Golgi compartments

    • Quantitative proteomics workflow for comprehensive interactome analysis

  • Microscopy-based interaction studies:

    • Fluorescence resonance energy transfer (FRET) between tagged MPPE1 and GPI-anchored proteins

    • Bimolecular fluorescence complementation (BiFC) for visualization of interactions

    • Super-resolution microscopy to detect co-localization at nanoscale

  • Functional interaction assays:

    • Transport assays measuring trafficking rates of GPI-anchored proteins

    • Knockdown/knockout studies to establish dependency relationships

    • Complementation assays in MPPE1-deficient cells

What are the current methodologies for studying the role of MPPE1 in lipid remodeling?

Advanced lipid analysis techniques:

  • Lipidomics approaches:

    • Liquid chromatography-mass spectrometry (LC-MS) for comprehensive GPI-anchor profiling

    • Multiple reaction monitoring (MRM) for targeted analysis of specific GPI species

    • Ion mobility-mass spectrometry for structural isomer discrimination

  • Metabolic labeling strategies:

    • Stable isotope labeling of GPI precursors

    • Pulse-chase experiments with labeled ethanolamine

    • Click chemistry-compatible analogues for tracking specific modifications

  • In vitro reconstitution systems:

    • Purified enzyme assays with defined GPI-anchor substrates

    • Liposome-based systems with incorporated MPPE1 and substrates

    • Fluorescent or radioactive reporter systems for quantitative measurements

  • Genetic manipulation approaches:

    • CRISPR-Cas9 knockout or knockdown of MPPE1

    • Rescue experiments with wild-type or mutant MPPE1

    • Comparative analysis between different cell types or species

How does MPPE1 dysfunction impact cellular processes in disease models?

Experimental approaches to study MPPE1 in disease contexts:

  • Disease model development:

    • CRISPR-engineered cell lines with MPPE1 mutations

    • Patient-derived cells with MPPE1 variants

    • Animal models with MPPE1 deficiency

  • Phenotypic characterization methods:

    • Transcriptomics to identify dysregulated pathways

    • Proteomics focusing on GPI-anchored protein abundance and localization

    • Live-cell imaging of ER-Golgi trafficking in normal vs. disease models

  • Specific disease relevance:

    • Hepatocellular carcinoma models (MPPE1 has been identified as a novel candidate gene)

    • Neurodegenerative disease models where GPI-anchored proteins play key roles

    • Immunological disorders involving GPI-anchored receptors

  • Rescue experiments:

    • Complementation with wild-type or mutant MPPE1

    • Small molecule interventions targeting affected pathways

    • Quantitative assessment of rescue efficiency using multiple parameters

What are the recommended approaches for conducting comparative studies between human and Macaca fascicularis MPPE1?

Comparative study design:

  • Sequence and structure analysis:

    • Multiple sequence alignment of human and macaque MPPE1

    • Homology modeling to identify structural differences

    • Conservation analysis of functional domains and catalytic residues

  • Functional comparison methods:

    • Parallel enzymatic activity assays under identical conditions

    • Cross-species complementation experiments

    • Substrate specificity profiling for both orthologs

  • Expression pattern analysis:

    • Tissue-specific expression comparison

    • Subcellular localization studies

    • Response to cellular stress or stimulation

  • Translation to human disease relevance:

    • Validation of cynomolgus monkey as a model for human MPPE1 function

    • Assessment of cross-reactivity of therapeutic approaches

    • Comparative pharmacological studies

Methodological considerations:

  • Use of standardized protocols to minimize technical variation

  • Appropriate statistical methods for cross-species comparisons

  • Consideration of genomic context and evolutionary constraints

What experimental designs are most effective for investigating MPPE1's role in the ER-Golgi transport pathway?

Recommended experimental approaches:

  • Trafficking assays:

    • Pulse-chase experiments with synchronized cargo

    • Live-cell imaging with fluorescently tagged GPI-anchored proteins

    • Vesicle isolation and characterization from different compartments

  • Perturbation strategies:

    • Acute inhibition using small molecules or rapidly inducible systems

    • Temperature-sensitive trafficking blocks combined with MPPE1 manipulation

    • Cargo-specific transport assays to determine selectivity

  • Interaction mapping:

    • Proximity labeling to identify MPPE1's interaction network in the ER-Golgi interface

    • Co-immunoprecipitation under native conditions

    • Genetic interaction screens to identify functional partners

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize MPPE1 localization

    • Correlative light and electron microscopy to link function with ultrastructure

    • FRET-based sensors to monitor MPPE1 activity in real-time

Experimental design considerations:

How can researchers validate MPPE1 as a potential disease biomarker or therapeutic target?

Validation methodology:

  • Biomarker validation approach:

    • Expression analysis in disease vs. healthy tissues

    • Correlation with disease progression and outcome

    • Development of specific detection assays (ELISA, mass spectrometry)

    • Prospective validation in clinical cohorts

  • Target validation strategy:

    • Genetic manipulation (knockdown, knockout, overexpression)

    • Phenotypic reversal in disease models

    • Pharmacological inhibition/activation studies

    • Identification of druggable sites or interactions

  • Translational methodology:

    • Development of cell-based screening assays

    • In vitro to in vivo correlation studies

    • Use of patient-derived samples for personalized approaches

    • Comparative studies between human and Macaca fascicularis models

  • Potential applications in hepatocellular carcinoma:

    • MPPE1 has been identified as a novel candidate gene in hepatocellular carcinoma

    • Validation steps should include expression analysis in tumor vs. normal tissue

    • Functional studies to determine mechanism of action in cancer cells

    • Correlation with clinical parameters and survival data

What are the best techniques for studying post-translational modifications of MPPE1?

State-of-the-art PTM analysis methods:

  • Mass spectrometry-based approaches:

    • Enrichment strategies for specific modifications (phosphorylation, glycosylation)

    • Top-down proteomics for intact protein analysis

    • Parallel reaction monitoring for targeted quantification

    • PTM crosstalk analysis using multi-dimensional separation

  • Site-specific modification analysis:

    • Site-directed mutagenesis of potential modification sites

    • Phospho-specific or glyco-specific antibodies

    • Chemical labeling strategies for specific modifications

    • Functional impact assessment of individual modifications

  • Dynamic PTM regulation study:

    • Pulse-chase experiments with PTM-specific labels

    • Stimulus-response studies under different cellular conditions

    • Enzyme-substrate relationships for each modification

    • Mathematical modeling of modification dynamics

  • PTM localization techniques:

    • Super-resolution microscopy with modification-specific probes

    • Subcellular fractionation combined with PTM analysis

    • Proximity labeling to identify modifying enzymes

    • Correlation of modifications with trafficking or activity states

Experimental design table for PTM analysis of MPPE1:

PTM TypeDetection MethodFunctional Validation ApproachExpected Impact
PhosphorylationPhospho-enrichment + LC-MS/MSPhosphomimetic mutationsRegulation of enzymatic activity
GlycosylationGlycosidase treatment + gel shiftSite-directed mutagenesisProtein stability and trafficking
UbiquitinationUbiquitin pulldown + MSProteasome inhibitionTurnover and quality control
PalmitoylationClick chemistry + fluorescent detectionAcyl-transferase inhibitionMembrane association

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.