Recombinant Macaca fascicularis Mitochondrial folate transporter/carrier (SLC25A32)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Macaca fascicularis Mitochondrial Folate Transporter/Carrier (SLC25A32)

The mitochondrial folate transporter, encoded by the SLC25A32 gene, is a crucial protein responsible for transporting tetrahydrofolate across the inner mitochondrial membrane. This transporter is part of the solute carrier family 25, which plays a significant role in various cellular processes by facilitating the transport of substrates across the mitochondrial membrane . While specific information on the recombinant Macaca fascicularis mitochondrial folate transporter/carrier (SLC25A32) is limited, understanding its function and significance can be inferred from studies on its human counterpart and related research in other species.

Function and Role of Mitochondrial Folate Transporter

The mitochondrial folate transporter is essential for transferring tetrahydrofolate (THF) from the cytosol into the mitochondria. THF is a critical carrier of one-carbon units, which are vital for various metabolic processes, including the synthesis of purines, pyrimidines, and amino acids . The transport of THF into mitochondria supports these metabolic pathways and is crucial for maintaining cellular homeostasis.

Neural Tube Defects (NTDs)

Studies in mice have shown that mutations in the Slc25a32 gene can lead to neural tube defects (NTDs), which are partially preventable by formate supplementation . This suggests that the mitochondrial folate transport system plays a critical role in early embryonic development, particularly in neural tube closure.

Riboflavin-Responsive Exercise Intolerance (RREI)

In humans, mutations in the SLC25A32 gene have been associated with riboflavin-responsive exercise intolerance (RREI), a condition that shares phenotypic features with multiple acyl-CoA dehydrogenase deficiency (MADD) . This highlights the transporter's importance in mitochondrial energy metabolism.

Bone Health

Polymorphisms in the SLC25A32 gene have been linked to lower plasma folate levels and an increased risk of fractures in postmenopausal women, suggesting a potential role in bone health .

Data Tables

Table 1: Key Features of Mitochondrial Folate Transporter (SLC25A32)

FeatureDescription
GeneSLC25A32
ProteinMitochondrial Folate Transporter
LocationInner Mitochondrial Membrane
FunctionTransports Tetrahydrofolate (THF)
Pathological AssociationsNeural Tube Defects, Riboflavin-Responsive Exercise Intolerance

Table 2: Pathological Implications of SLC25A32 Mutations

ConditionDescription
Neural Tube Defects (NTDs)Associated with mutations in Slc25a32; partially rescued by formate supplementation
Riboflavin-Responsive Exercise Intolerance (RREI)Linked to mutations in SLC25A32; shares features with MADD
Bone Health ImplicationsPolymorphisms associated with lower folate levels and increased fracture risk

References

  1. Mitochondrial Folate Transporter. Wikipedia. [Accessed 2025-02-12].

  2. Formate rescues neural tube defects caused by mutations in Slc25a32. [PDF] Laboratory of Genetic Engineering and School of Life Sciences of Fudan University.

  3. The SLC25 Mitochondrial Carrier Family: Structure and Mechanism. PMC.

  4. SLC25A32 solute carrier family 25 member 32 [Homo sapiens]. NCBI.

  5. Polymorphism of SLC25A32, the folate transporter gene. PubMed.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us for preferential development.
Synonyms
SLC25A32; MFTC; QmoA-10785; QtrA-13024; Mitochondrial folate transporter/carrier; Solute carrier family 25 member 32
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-315
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
SLC25A32
Target Protein Sequence
MTGQGHSASGSSAWSTVFRHVRYENLVAGVSGGVLSNLALHPLDLVKIRFAVSDGLELRP KYNGILHCLTTIWKLDGLRGLYQGVTPNVWGAGLSWGLYFFFYNAIKSYKTEGRAERLEA TEYLVSAAEAGAMTLCITNPLWVTKTRLMLQYDAVINSPHRQYKGMFDTLVKIYKYEGVR GLYKGFVPGLFGTSHGALQFMAYELLKLKYNQHINRLPEAQLSTVEYISVAALSKIFAVA ATYPYQVVRARLQDQHMFYSGVIDVITKTWRKEGIGGFYKGIAPNLIRVTPACCITFVVY ENVSHFLLDLREKRK
Uniprot No.

Target Background

Function
This protein functions as a mitochondrial folate transporter, facilitating the transport of folate across the inner mitochondrial membrane. It also exhibits the ability to transport FAD across the same membrane.
Database Links

KEGG: mcf:102144981

UniGene: Mfa.2396

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is SLC25A32 and what is its primary function?

SLC25A32 (Solute Carrier Family 25 Member 32) is a 35 kDa protein encoded by the SLC25A32 gene located on chromosome 8q22.3 in humans, containing seven exons . This protein is ubiquitously expressed across tissues and functions as a transporter at the inner mitochondrial membrane .

While initially described as a mitochondrial folate transporter, current evidence suggests SLC25A32 primarily functions as a mitochondrial FAD transporter . This dual functionality creates an interesting research paradigm, as SLC25A32 plays crucial roles in both folate metabolism and flavoenzyme function. Methodologically, this dual role was established through complementation studies in yeast with FAD transport defects and through experimental models examining folate pathway disruptions .

What are the optimal storage conditions for recombinant SLC25A32 protein?

For maintaining the stability and activity of recombinant Macaca fascicularis SLC25A32 protein, the following storage conditions are recommended:

  • Store at -20°C for regular use

  • For extended storage periods, conserve at -20°C or -80°C

  • Use a storage buffer consisting of Tris-based buffer with 50% glycerol, optimized for this specific protein

  • Avoid repeated freezing and thawing cycles as this can significantly compromise protein integrity

  • For active research, working aliquots can be stored at 4°C for up to one week

These storage conditions are methodologically important because improper storage can lead to protein degradation, loss of transport activity, and potential experimental artifacts.

How can SLC25A32 expression be effectively knocked down or overexpressed in experimental models?

For effective manipulation of SLC25A32 expression in research models, the following methodological approaches have proven successful:

For knockdown experiments:
Small interfering RNAs (siRNAs) can be used with the following validated sequences:

  • si-SLC25A32#1: GCUGCCAUCAACACAAUGUTT

  • si-SLC25A32#2: GCAGAUGAAUGCUUUAUAATT

Transfection should be performed using Lipofectamine™ 2000 (Invitrogen) following the manufacturer's protocols. This approach has demonstrated significant reduction in SLC25A32 expression in various cell lines, particularly in glioblastoma models .

For overexpression experiments:
The full-length SLC25A32 cDNA should be inserted into an appropriate expression vector (such as pENTER). Plasmid DNA transfection can be performed using DNA transfection reagents like Lipofectamine lipo3000 (Invitrogen) . When optimizing transfection conditions, cell type-specific parameters should be considered to maximize expression while minimizing cytotoxicity.

Verification of successful knockdown or overexpression should be conducted using both qRT-PCR for mRNA expression and Western blotting for protein levels, ideally 48-72 hours post-transfection.

What is the relationship between SLC25A32 and FAD transport in mitochondria?

SLC25A32 plays a critical role in mitochondrial FAD transport, which directly impacts multiple flavoenzyme-dependent pathways. Research has established that:

  • SLC25A32 was definitively identified as a mitochondrial FAD transporter through functional complementation studies in FLX1-mutated yeast strains with mitochondrial FAD transport defects

  • Mutations in SLC25A32 specifically block mitochondrial uptake of FAD

  • Experimental evidence shows a positive correlation between SLC25A32 dysfunction and flavoenzyme deficiency

  • The impaired flavoenzymes include those involved in:

    • Fatty acid β-oxidation

    • Amino acid metabolism

    • The glycine cleavage system (specifically the dihydrolipoamide dehydrogenase subunit)

This transport function is methodologically important as it explains why SLC25A32 deficiency impacts multiple metabolic pathways simultaneously. For researchers, this suggests that experimental designs should account for these various metabolic pathways when studying SLC25A32 dysfunction.

How does SLC25A32 contribute to neural tube defects (NTDs) and what experimental models exist to study this relationship?

SLC25A32 dysfunction has been directly linked to neural tube defects through several mechanistic pathways. The most robust experimental model developed to date involves knockout and knock-in mouse models with specific SLC25A32 mutations.

Experimental mouse models include:

  • Homozygous knockout (−/− Slc25a32) mice

  • Homozygous knock-in mice (Y174C/Y174C Slc25a32)

  • Compound heterozygous knock-in mice (K235R/K235R Slc25a32)

  • Combined homozygous knock-out mice (Y174C/K235R Slc25a32)

The Y174C/K235R Slc25a32 mice die in utero with neural tube defects, making them a particularly valuable model for studying NTD development. Mechanistically, SLC25A32 deficiency leads to NTDs through:

  • Mitochondrial FAD transport blockage

  • Impairment of the glycine cleavage system, specifically dihydrolipoamide dehydrogenase

  • Resulting glycine accumulation and glycine-derived formate reduction

  • Disturbed folate-mediated one-carbon metabolism

  • 5-methyltetrahydrofolate shortage and accumulation of other folate intermediates

Importantly, maternal formate supplementation has been shown to increase 5-methyltetrahydrofolate levels and ameliorate NTDs in −/− Slc25a32 embryos, providing both a mechanistic insight and potential intervention strategy .

What is the role of SLC25A32 in cancer progression, particularly in glioblastoma (GBM)?

SLC25A32 has emerged as a significant factor in cancer progression, with particularly strong evidence for its role in glioblastoma. The following findings highlight its importance:

Expression patterns:

  • SLC25A32 expression is significantly elevated in GBM compared to normal brain tissue

  • Expression levels positively correlate with glioma grade (higher in high-grade vs. low-grade gliomas)

  • High SLC25A32 expression is associated with poorer prognosis in glioma patients

Functional significance:

  • Knockdown of SLC25A32 inhibits proliferation and invasion of GBM cells

  • Overexpression significantly promotes cell growth and invasion

  • These effects are primarily mediated through activation of the PI3K-AKT-mTOR signaling pathway

Methodological approaches for studying SLC25A32 in GBM:

  • Expression analysis via Western blotting, qRT-PCR, and immunohistochemistry

  • Functional assays including:

    • CCK-8 assays and colony formation assays for proliferation

    • EdU incorporation assays for DNA synthesis

    • 3D sphere invasion assays and ex vivo co-culture invasion models for invasive potential

These findings suggest SLC25A32 could serve as both a prognostic biomarker and potential therapeutic target in GBM. For researchers, targeting the SLC25A32-PI3K-AKT-mTOR axis may represent a novel therapeutic approach for GBM treatment.

What techniques are most effective for studying SLC25A32 transport function in isolated mitochondria?

To effectively study SLC25A32 transport function in isolated mitochondria, researchers should consider the following methodological approaches:

Mitochondrial isolation and preparation:

  • Differential centrifugation from fresh tissue samples or cultured cells

  • Purification through Percoll gradient centrifugation

  • Assessment of mitochondrial integrity through cytochrome c oxidase activity or respiratory control ratio measurements

Transport activity assays:

  • Direct transport measurement: Using radiolabeled substrates (³H-folate or ¹⁴C-FAD) to measure uptake into isolated mitochondria

  • Indirect functional assays: Measuring the activity of mitochondrial flavoenzymes as a proxy for FAD transport

  • Reconstitution assays: Incorporating purified SLC25A32 into liposomes to measure substrate transport in a defined system

Analysis of transport kinetics:

  • Determination of Km and Vmax values for different substrates

  • Competition assays with structural analogs to define substrate specificity

  • Investigation of pH and membrane potential dependence of transport activity

When interpreting results, researchers should account for potential confounding factors including mitochondrial integrity, membrane potential status, and the presence of other transporters with overlapping substrate specificities.

How can the dual role of SLC25A32 in FAD and folate transport be experimentally distinguished?

Distinguishing between the FAD and folate transport functions of SLC25A32 requires sophisticated experimental approaches:

Substrate-specific transport assays:

  • Parallel transport assays using radiolabeled FAD and folate compounds

  • Comparison of transport kinetics and inhibition profiles

  • Competition experiments between FAD and folate derivatives

Mutation analysis:

  • Introduction of site-specific mutations targeting predicted substrate binding sites

  • Analysis of differential effects on FAD versus folate transport

  • Structure-function relationship studies based on homology modeling

Metabolic rescue experiments:

  • In SLC25A32-deficient models, compare rescue effects of FAD versus folate supplementation

  • Analyze downstream metabolic pathways specific to either FAD or folate metabolism

  • Measure flavoenzyme activities versus one-carbon metabolism markers

Recent evidence strongly supports a primary role for SLC25A32 in FAD transport, with experimental data showing:

  • SLC25A32 mutations specifically block mitochondrial uptake of FAD

  • Mitochondrial uptake of folate is not hindered by SLC25A32 mutations

  • A clear correlation exists between SLC25A32 dysfunction and flavoenzyme deficiency

This methodological distinction is critical for researchers to correctly interpret the metabolic consequences of SLC25A32 deficiency.

What are the key considerations when designing experiments to study SLC25A32 function in different species models?

When designing experiments to study SLC25A32 across different species models, researchers should consider:

Sequence homology and functional conservation:

SpeciesProtein Similarity to Human SLC25A32Key Experimental Considerations
Macaca fascicularis~95%Closest non-human primate model; highly relevant for translational studies
Mus musculus~85%Well-established genetic models available; suitable for in vivo studies
Rattus norvegicus~84%Good model for biochemical and physiological studies
Zebrafish~70%Useful for developmental studies, especially NTDs
Yeast (S. cerevisiae)~40% (functional homolog: FLX1)Excellent for complementation studies and basic transport function

Methodological considerations:

  • Expression systems: Choose systems that correctly process post-translational modifications relevant to the species being studied

  • Subcellular localization: Verify mitochondrial targeting in each model organism

  • Functional redundancy: Assess the presence of other transporters that might compensate for SLC25A32 deficiency

  • Tissue-specific expression patterns: These may vary significantly between species

  • Metabolic context: Consider species differences in one-carbon metabolism and FAD utilization

Data interpretation challenges:

  • Cross-species variations in mitochondrial metabolism may affect the phenotypic consequences of SLC25A32 deficiency

  • Regulatory mechanisms controlling SLC25A32 expression might differ between species

  • The relative importance of FAD versus folate transport functions may vary across evolutionary lineages

How can researchers reconcile contradictory findings regarding SLC25A32 function in different experimental systems?

Contradictory findings regarding SLC25A32 function can be approached methodologically through:

Systematic analysis of experimental variables:

  • Cell/tissue type differences: Different tissues have varying metabolic requirements and may rely differently on SLC25A32 function

  • Expression level considerations: Endogenous versus overexpression studies may yield different results

  • Genetic background effects: Compensatory mechanisms may exist in certain genetic backgrounds

  • Temporal factors: Acute versus chronic SLC25A32 deficiency may trigger different cellular responses

Integrated multi-omics approaches:

  • Combine transcriptomics, proteomics, and metabolomics data to build comprehensive models of SLC25A32 function

  • Network analysis to identify key interaction partners and regulatory relationships

  • Flux analysis to quantify the impact on specific metabolic pathways

Resolution strategies for specific contradictions:

  • FAD vs. folate transport: Current evidence suggests SLC25A32 primarily transports FAD, with folate metabolism effects occurring secondarily through flavoenzyme dysfunction

  • Cancer-specific effects: SLC25A32 may have context-dependent effects in different cancer types, potentially through interaction with tissue-specific metabolic programs

  • Developmental consequences: The severity of developmental defects in SLC25A32 deficiency models varies by genetic background and environmental factors

Researchers should design experiments with internal controls that can directly address contradictory findings from the literature, ideally within the same experimental system.

What are the most promising therapeutic applications for targeting SLC25A32 in disease conditions?

Based on current evidence, several therapeutic applications for targeting SLC25A32 show promise:

Cancer therapy:

  • SLC25A32 inhibition could disrupt cancer metabolism, particularly in GBM where its expression is elevated and associated with poor prognosis

  • Combined inhibition of SLC25A32 and the PI3K-AKT-mTOR pathway could provide synergistic anti-tumor effects

  • Cancer-specific metabolic vulnerabilities might be exploited through selective SLC25A32 modulation

Neural tube defect prevention:

  • Maternal supplementation with formate has shown promise in ameliorating NTDs in SLC25A32-deficient mouse models

  • Targeted delivery of FAD or downstream metabolites could bypass SLC25A32 deficiency

  • Genetic screening for SLC25A32 variants could identify pregnancies at risk for NTDs

Metabolic disorders:

  • Riboflavin-responsive exercise intolerance (RREI) and Multiple acyl-coenzyme A dehydrogenation deficiency (MADD) associated with SLC25A32 mutations may benefit from high-dose riboflavin supplementation

  • Targeted metabolic support based on the specific consequences of SLC25A32 dysfunction (e.g., glycine metabolism)

Future therapeutic development should consider:

  • Tissue-specific requirements for SLC25A32 function

  • Potential off-target effects of systemic SLC25A32 inhibition

  • Opportunities for combination therapies targeting complementary metabolic pathways

  • Genetic testing to identify patients most likely to benefit from targeted interventions

What novel techniques are emerging for studying the structure-function relationship of mitochondrial transporters like SLC25A32?

Several cutting-edge techniques are revolutionizing our understanding of mitochondrial transporters like SLC25A32:

Advanced structural biology approaches:

  • Cryo-electron microscopy (cryo-EM): Allowing visualization of membrane proteins in near-native states without crystallization

  • Integrative structural biology: Combining multiple experimental techniques (X-ray crystallography, NMR, SAXS, mass spectrometry) with computational modeling

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Providing insights into protein dynamics and conformational changes during transport

Functional genomics and editing technologies:

  • CRISPR-Cas9 base editing: Creating precise point mutations to study structure-function relationships

  • CRISPR screens: Identifying genetic modifiers of SLC25A32 function

  • Single-cell multi-omics: Revealing cell-to-cell variability in transporter function and its metabolic consequences

Advanced imaging techniques:

  • Super-resolution microscopy: Visualizing mitochondrial transporters at nanoscale resolution

  • Genetically encoded fluorescent sensors: Monitoring substrate concentrations in real-time

  • Correlative light and electron microscopy (CLEM): Linking functional data to ultrastructural context

In silico approaches:

  • Molecular dynamics simulations: Modeling substrate binding and transport mechanisms

  • Deep learning methods: Predicting protein-substrate interactions and transport kinetics

  • Systems biology modeling: Integrating transporter function into whole-cell metabolic networks

These emerging techniques will likely resolve long-standing questions about SLC25A32, including the structural basis for its dual transport capabilities and how specific mutations affect substrate recognition and transport efficiency.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.