Recombinant Macaca fascicularis Myelin-oligodendrocyte glycoprotein (MOG)

Shipped with Ice Packs
In Stock

Description

General Information

  • Protein Names: Myelin-oligodendrocyte glycoprotein

  • Uniprot No.: Q9BGS7

  • Source: in vitro E. coli expression system

  • Expression Region: 30-247

  • Tag Info: N-terminal 10xHis-tagged

  • Protein Length: Full Length of Mature Protein

  • Immunogen Species: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Structure and Function

MOG is a 28 kDa single-pass transmembrane glycoprotein that belongs to the immunoglobulin superfamily . The protein consists of:

  • A 28 amino acid signal sequence.

  • A 128 amino acid extracellular domain (ECD) containing an Ig-like domain .

  • A 21 amino acid transmembrane domain .

  • A 69 amino acid cytosolic fragment featuring a hydrophobic domain that associates with the cytoplasmic face of the plasma membrane .

The ECD of mature mouse MOG shares 90% and 95% amino acid sequence identity with the ECD of human and rat MOG, respectively . MOG is expressed by oligodendrocytes in the CNS and is localized to the outer layer of the myelin sheath, as well as in the oligodendrocyte plasma membrane . MOG may function as an adhesion molecule and a mediator of immune activation in the CNS .

Role in Autoimmune Diseases

MOG is a target for autoimmune diseases that cause demyelination in the CNS . Specifically, antibodies against MOG (MOG-Abs) have been identified in patients with demyelinating disorders .

Experimental Autoimmune Encephalomyelitis (EAE) Model

The recombinant Macaca fascicularis MOG is utilized in experimental autoimmune encephalomyelitis (EAE) models to study multiple sclerosis (MS) . EAE is an animal model for multiple sclerosis and related CNS demyelinating diseases . Immunization with recombinant human MOG can induce EAE in cynomolgus monkeys, mimicking the clinical and pathological features of MS .

Table 1: EAE Induction in Cynomolgus Monkeys Using Recombinant Human MOG

GroupAntigenEAE Development RateClinical Course
1rhMOG1-125100%Acute fulminant
2MOG34-56100%Mild
ControlN/AN/AN/A

rhMOG1-125: recombinant human myelin oligodendrocyte glycoprotein extracellular domain (1-125). MOG34-56: synthetic peptide 34-56 of human myelin oligodendrocyte glycoprotein .

Applications in Research

Recombinant MOG proteins are used in various research applications, including:

  • EAE Induction: Inducing EAE in animal models to study the pathogenesis of MS and test new therapeutic strategies .

  • Neurite Outgrowth Assays: Promoting neurite outgrowth in neuronal cultures, indicating its role in neuronal development and regeneration .

  • Immunological Studies: Investigating the immune responses to MOG, including T cell and antibody responses, to understand the mechanisms of autoimmune demyelination .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a particular tag type, please inform us, and we will prioritize its implementation.
Synonyms
MOG; QflA-14648; Myelin-oligodendrocyte glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-247
Protein Length
Full Length of Mature Protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
MOG
Target Protein Sequence
GQFRVIGPRQPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGRDQDGE QAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAIELKVEDPFY WVSPAVLVLLAVLPVLLLQITVGLVFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKI TLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF
Uniprot No.

Target Background

Function

A minor component of the myelin sheath, Myelin-oligodendrocyte glycoprotein (MOG) may be involved in myelin sheath formation and maintenance, as well as in cell-cell communication. It mediates homophilic cell-cell adhesion.

Database Links

KEGG: mcf:102118842

UniGene: Mfa.465

Protein Families
Immunoglobulin superfamily, BTN/MOG family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Macaca fascicularis MOG and how does it differ from human MOG?

Myelin oligodendrocyte glycoprotein (MOG) is a type I transmembrane protein located at the surface of central nervous system (CNS) myelin. Macaca fascicularis (cynomolgus macaque) MOG shares high sequence homology with human MOG, making it valuable for translational research.

The extracellular immunoglobulin variable (IgV) domain of MOG is particularly well-conserved across species. Sequence analysis reveals that macaque MOG contains the critical epitope region "VEDPFYWVS" that differs slightly from the rat sequence "VEDPFYWIN" . The core structure of MOG adopts an IgV-like fold consisting of a sandwich of two antiparallel β-sheets (A'GFCC'C" and ABED) .

Key differences between macaque and human MOG are primarily found in non-conserved regions, particularly within the FG loop sequence R101DHSYQEE108, which forms a major antibody recognition site . These subtle differences must be considered when designing cross-species experiments.

Why use Macaca fascicularis MOG rather than mouse or rat MOG in experimental models?

Cynomolgus macaques represent a superior model for human neurological disorders for several reasons:

  • Phylogenetic proximity: Macaques are phylogenetically much closer to humans than rodents, with immune systems that more closely mimic human responses .

  • Antibody responses: Unlike rodent models, macaques develop robust antibody responses against MOG without requiring additional bacterial components. While rodent EAE typically requires complete Freund's adjuvant (CFA) containing mycobacterial wall components, macaque EAE can be efficiently induced with recombinant MOG in incomplete Freund's adjuvant (IFA) .

  • Disease manifestation: Macaques develop forms of experimental autoimmune encephalitis (EAE) that more accurately reflect human demyelinating diseases, including progressive forms that are difficult to model in rodents .

  • MHC diversity: The macaque MHC (Mafa) system, while organized similarly to humans, provides a valuable model for studying MHC-restricted immune responses .

What are the optimal expression systems for producing recombinant Macaca fascicularis MOG?

Multiple expression systems have been developed for recombinant MOG production, each with distinct advantages:

Bacterial Expression Systems:

  • Traditional E. coli systems: While high-yielding, they typically produce insoluble MOG that requires denaturation and refolding .

  • SHuffle E. coli strains: These engineered strains facilitate disulfide bond formation in the cytoplasm, producing soluble, properly folded MOG at yields >100 mg/L .

Mammalian Expression Systems:

  • HEK293 cells: These produce properly glycosylated MOG with native folding, especially important for conformational epitope studies .

Comparative Production Methods:

Expression SystemYieldFolding QualityGlycosylationApplication Suitability
Standard E. coliHighPoor (requires refolding)NoneT cell studies
SHuffle E. coli>100 mg/LGoodNoneEAE induction, B & T cell studies
HEK293LowerExcellentNativeConformational antibody studies

For most EAE induction protocols, properly folded protein is critical as antibody-dependent disease mechanisms require conformational epitopes .

How can researchers assess the purity and proper folding of recombinant Macaca fascicularis MOG?

Quality assessment of recombinant MOG should include:

  • Purity analysis:

    • Bis-Tris PAGE showing >95% purity

    • HPLC analysis confirming homogeneity

    • Mass spectrometry to detect bacterial contaminants

  • Structural verification:

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to confirm monomeric state

    • Differential scanning fluorimetry to assess thermal stability and proper folding

  • Functional validation:

    • ELISA binding assays with conformation-dependent antibodies like 8-18C5

    • Flow cytometry using MOG-expressing cells (e.g., HEK293) to confirm binding of MOG-specific antibodies

    • T cell proliferation assays with MOG-specific T cell receptors

The presence of properly formed disulfide bonds is critical for MOG's conformational epitopes. Improperly folded MOG leads to exposure of different epitopes and altered disease induction potential .

What impact do bacterial contaminants have on MOG quality and experimental outcomes?

Bacterial contaminants in recombinant MOG preparations significantly alter disease outcomes in experimental models:

A key study in cynomolgus macaques demonstrated that trace amounts of E. coli contaminants within recombinant human MOG preparations "significantly modulate the severity of clinical, radiological, and histologic hallmarks of EAE" . Specifically:

  • Animals receiving the purest MOG showed milder disease severity

  • Higher-purity MOG resulted in increased numbers of remissions

  • Purer preparations led to reduced brain damage

  • Lower-purity preparations with bacterial contaminants produced fulminant disease with fewer remissions

Mechanism: Bacterial components like lipopolysaccharides (LPS) act as additional immune activators, triggering stronger inflammatory responses through pattern recognition receptors. This creates a more aggressive disease phenotype that may not accurately model the human condition .

To minimize contaminant effects, researchers should:

  • Use mammalian expression systems when possible

  • Employ endotoxin removal steps during purification

  • Test final preparations for endotoxin (<1 EU per μg by LAL method)

  • Include endotoxin measurement data in publications

What are the optimal immunization protocols for inducing EAE using Macaca fascicularis MOG?

Effective EAE induction with Macaca fascicularis MOG requires careful protocol design:

Immunization formulation:

  • Recombinant MOG (typically 100-300 μg) in incomplete Freund's adjuvant (IFA)

  • Unlike rodent models, additional mycobacterial components are not required

Key protocol variables:

  • MOG purity: Higher purity induces milder, more remitting disease forms

  • Boosting regimen: Multiple boosters of IgV-MOG in IFA are critical for atypical or unusual EAE forms

  • Adjuvant selection: IFA alone is sufficient, unlike rodent models requiring CFA

Clinical monitoring parameters:

  • Regular neurological assessments

  • MRI evaluations for CNS lesions

  • Flow cytometric analysis of peripheral immune cells

  • Serological assessment of anti-MOG antibody titers

A recommended timeline based on published protocols:

  • Day 0: Primary immunization

  • Days 14-28: Booster immunizations (1-2 administrations)

  • Days 7-60: Clinical monitoring for disease onset and progression

  • Terminal analysis: Histopathological evaluation of CNS tissues

How should researchers account for MHC polymorphism when designing experiments with Macaca fascicularis MOG?

MHC polymorphism significantly impacts immune responses to MOG in Macaca fascicularis. Researchers should:

  • Select animals based on geographical origin: Cynomolgus macaques from different regions (continental vs. island populations) show distinct genetic differentiation. The MHC polymorphism varies dramatically between populations .

  • Characterize MHC alleles: Various methods can determine MHC genotypes:

    • Denaturing gradient gel electrophoresis (DGGE) sequencing of exon 2

    • PCR sequence-specific oligonucleotide testing

    • cDNA cloning and sequencing

  • Match experimental groups: To reduce variability, experimental groups should contain animals with similar MHC backgrounds, particularly for:

    • Vaccine studies

    • Transplantation experiments

    • Autoimmune disease models

Population-specific considerations:
The Filipino cynomolgus macaque population shows 20 DRB haplotypes, with specific haplotypes dominating certain geographical areas. The Mauritian cynomolgus macaque population has even lower MHC diversity due to founder effects, making them particularly valuable for controlled experiments .

As stated in the literature: "In order to improve the power of animal experiments while keeping the number of individuals used as low as possible, it is necessary to select animals sharing a common geographical origin and to systematically select animals with the experimentally appropriate polymorphic alleles in loci known to influence immune-related responses" .

How can researchers distinguish between different forms of EAE induced by varying MOG preparations?

MOG-induced EAE in Macaca fascicularis can present with distinct clinical, radiological, and histopathological features based on the preparation quality:

Clinical manifestations:

  • Fulminant form: Rapid onset, severe neurological deficits, fewer remissions

  • Progressive form: Slower onset, more remitting-relapsing pattern

  • Milder forms: Less severe deficits, higher remission rates

Radiological assessment:
Use standardized MRI protocols to evaluate:

  • Lesion number and distribution

  • Gadolinium enhancement (indicating BBB breakdown)

  • Brain volume and atrophy measurements

  • Quantitative measures of demyelination

Histopathological evaluation:
Key parameters include:

  • Distribution of demyelinated lesions

  • Cellular infiltrate composition (T cells, B cells, macrophages)

  • Axonal damage markers

  • Complement deposition patterns

Differentiating features by MOG preparation:
Animals receiving purer MOG preparations typically show:

  • "Milder disease severity"

  • "Increased numbers of remissions"

  • "Reduced brain damage"

  • "Wider diversity of lesion types"

This differentiation is critical for proper data interpretation, as the model selected should reflect the specific human pathology being studied.

How should variability in immune responses to MOG across different Macaca fascicularis populations be addressed?

Significant genetic variation exists across Macaca fascicularis populations, affecting experimental outcomes:

Population-specific genetic factors:

  • Geographical origin: Continental (Vietnam, Malaysia) vs. island populations (Mauritius, Philippines) show distinct genetic profiles

  • MHC diversity: Filipino populations show 20 DRB haplotypes, while Mauritian populations have limited diversity due to genetic bottlenecks

  • Mitochondrial genetics: Analysis of mitochondrial genomes reveals substantial population structure even within regional groups

Strategies to address variability:

  • Standardize animal selection:

    • Use animals from a single geographical origin within each study

    • Characterize and report MHC haplotypes of experimental animals

    • Consider using Mauritian macaques for studies requiring genetic homogeneity

  • Statistical approaches:

    • Conduct power analyses accounting for anticipated genetic variability

    • Use larger group sizes when working with genetically diverse populations

    • Apply mixed-effects models that can account for genetic background as a random effect

  • Reporting standards:

    • Always document the geographical origin of macaques

    • Report genetic characterization methods and results

    • Include MHC typing data in published results

As noted in the literature: "The MHC genotype plays a key role in the selection of animals in all fields of medical research involving immune responses" . Researchers should therefore thoroughly document genetic backgrounds to enhance experimental reproducibility.

How can recombinant Macaca fascicularis MOG be used to study B cell-dependent autoimmune mechanisms?

Macaca fascicularis MOG provides an excellent model for studying B cell-dependent autoimmunity:

Experimental approaches:

  • B cell-dependent EAE models:

    • Immunization with properly folded recombinant MOG induces B cell-dependent EAE

    • This model fails in B cell-deficient animals, confirming the B cell dependency

    • The model allows for studying antibody-mediated demyelination mechanisms

  • Conformational epitope mapping:

    • The crystal structure of MOG reveals that the 8-18C5 antibody binds to three loops (BC, C'C", and FG) at the membrane-distal surface

    • The FG loop (sequence R101DHSYQEE108) forms a dominant component for antibody recognition

    • Using site-directed mutagenesis of recombinant MOG, researchers can map pathogenic epitopes

  • Cross-species molecular mimicry studies:

    • The unique DHSYQEE sequence in MOG has been found in Chlamydia trachomatis proteins

    • This provides a model for testing molecular mimicry as a mechanism for autoimmunity induction

    • Researchers can immunize with Chlamydia proteins containing homologous sequences and test for cross-reactive antibodies

Methodology for antibody analysis:

  • Flow cytometry using MOG-transfected HEK cells to detect conformational antibodies

  • Competition binding assays with known demyelinating antibodies like 8-18C5

  • B cell repertoire analysis using MOG tetramers for antigen-specific B cell isolation

What structural features of Macaca fascicularis MOG are critical for antibody recognition and disease induction?

The structural biology of MOG provides critical insights into pathogenic mechanisms:

Key structural features:

  • IgV domain fold:

    • MOG adopts an IgV-like fold with two antiparallel β-sheets (A'GFCC'C" and ABED)

    • The correct folding of this domain is essential for conformational epitope presentation

  • Critical epitope regions:

    • FG loop (R101DHSYQEE108): Forms a dominant binding site for pathogenic antibodies

    • BC loop: Contains the N-glycosylation site (Asn-31) and contributes to antibody binding

    • C'C" loop: Forms part of the conformational epitope recognized by 8-18C5

  • Putative ligand-binding cavity:

    • The A'GFCC'C" sheet harbors a cavity similar to that used by costimulatory molecule B7-2

    • This cavity may interact with an unknown ligand

    • Antibody binding to the FG loop may disrupt this potential interaction

Structure-function relationships:

Structural ElementFunctionRelevance to Disease
FG loop (aa 101-108)Dominant antibody bindingPrimary target for pathogenic antibodies
Disulfide bondsMaintain conformational epitopesCritical for demyelinating antibody recognition
N-glycosylation siteModifies protein conformationAffects antibody binding affinity
Putative ligand binding sitePotential signaling functionMay explain MOG's role in cytoskeleton organization

The literature notes: "The strained loop conformation with dihedral angles of His-103 in forbidden regions of the Ramachandran plot... provides a simple explanation for the failure to detect this antigenic region by peptide mapping with linear peptides that are unable to reproduce this strained loop structure" . This highlights why properly folded recombinant protein is essential for studying pathogenic antibody responses.

What are the latest methodological advances in purifying and characterizing recombinant Macaca fascicularis MOG?

Recent technological developments have significantly improved MOG production and characterization:

Production innovations:

  • SHuffle E. coli expression system:

    • Engineered E. coli strain facilitates disulfide bond formation in the cytoplasm

    • Produces soluble, properly folded MOG without denaturation/refolding

    • Yields >100 mg/L of purified protein

    • Combines "the high yield and speed of bacterial cell expression with enhanced disulfide bond formation and folding"

  • Advanced purification techniques:

    • Affinity chromatography using His-tags or other fusion tags

    • Size exclusion chromatography to ensure monomeric protein

    • Endotoxin removal strategies to minimize bacterial contaminants

Characterization methods:

  • Structural analysis:

    • SEC-MALS to confirm monomeric state and homogeneity

    • Differential scanning fluorimetry to assess thermal stability

    • Circular dichroism to evaluate secondary structure content

  • Functional assessment:

    • In vitro T cell proliferation assays with MOG-specific TCRs

    • Flow cytometry using MOG-transfected cells and conformation-specific antibodies

    • EAE induction to confirm biological activity

  • Contaminant analysis:

    • Mass spectrometry to detect bacterial protein contaminants

    • Limulus amebocyte lysate (LAL) assay for endotoxin quantification (<1 EU/μg)

    • Protein aggregation analysis using dynamic light scattering

These methodological advances allow researchers to produce higher quality recombinant MOG that more accurately models the native protein, enhancing experimental relevance and reproducibility in demyelinating disease research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.