Recombinant Macaca fascicularis N-acetyltransferase 14 (NAT14)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Macaca fascicularis N-acetyltransferase 14 (NAT14)

N-acetyltransferases (NATs) are a family of enzymes that catalyze the transfer of acetyl groups from acetyl-CoA to arylamines, hydrazines, and other substrates . In humans, NATs play a crucial role in the metabolism of various endogenous and exogenous compounds, including drugs and carcinogens . Macaca fascicularis, also known as the cynomolgus macaque, is a non-human primate widely used in drug metabolism studies due to the molecular and enzymatic similarities of its NATs to human orthologs . Recombinant Macaca fascicularis N-acetyltransferase 14 (NAT14) refers to the synthetically produced form of the NAT14 enzyme from Macaca fascicularis .

Gene and Protein Information

The human NAT14 gene, also known as N-acetyltransferase 14 (putative), is located on chromosome 19 . While NAT14 is identified as a putative N-acetyltransferase, research suggests that NAT14 does not catalyze the synthesis of N-acetylaspartate (NAA) from L-aspartate and acetyl-CoA, unlike NAT8L . The Macaca fascicularis NAT14 gene has the gene ID: 102123243 and is a protein coding gene .

NAT1/2 Polymorphisms in Macaques

Genetic polymorphisms in NAT1 and NAT2 have been investigated in Macaca fascicularis . These enzymes exhibit considerable inter-individual variability, which can affect drug metabolism . Studies involving resequencing of NAT1 and NAT2 genes in cynomolgus macaques have revealed several non-synonymous variants .

  • NAT1 Variants: 15 non-synonymous variants were identified. Nine (60%) of these variants were unique to cynomolgus macaques .

  • NAT2 Variants: 11 non-synonymous variants and 1 insertion/deletion variant were found. Seven (67%) variants were unique to cynomolgus macaques .

Functional characterization of mutant enzymes expressed in Escherichia coli showed that the D122N NAT1 variant had lower acetylation activity toward p-aminobenzoic acid but higher activity toward isoniazid compared to wild-type NAT1 . Liver cytosolic fractions from cynomolgus macaques homozygous for T98A NAT2 showed significantly lower acetylation activities toward isoniazid than wild-type NAT2, with similar results obtained for recombinant T98A NAT2 .

NAT1*14B Variant

In humans, the NAT114B variant is associated with a higher frequency of smoking-induced lung cancer and is the most common "slow acetylator" arylamine NAT1 genetic variant . NAT114B is characterized by a single nucleotide polymorphism (G560A) that results in an amino acid substitution (R187Q) . This substitution can affect the protein's stability, substrate specificity, and catalytic activity .

Applications in Experimental Medicine

Cynomolgus macaques are valuable in experimental medicine due to their genetic proximity to humans . They are used in various studies, including safety testing, pharmacokinetic testing, and pharmacological efficacy testing . Polymorphisms in the major histocompatibility complex (MHC) of Macaca fascicularis play a crucial role in experimental allografts of organs and stem cells and influence the immune response against infectious pathogens and vaccines .

Recombinant Protein Production

Recombinant NAT14 protein can be produced using various expression systems . These systems allow for the synthesis of the protein in a controlled environment, facilitating research and functional studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Advance notification is required, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
NAT14; QccE-12666; Probable N-acetyltransferase 14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
Target Protein Sequence
MAPSHLSVREVREDEKPLVLEMLKAGVKDTENRVALHALTRPPALLLLAAASSGLRFVLA SFALALLLPVFLAVTAVKLGLRARWGSLPPPGGLGGPWVAVRGSGDVCGVLALAPGTNAG DGARVTRLSVSRWHRRRGVGRRLLAFAEARARAWAGGMGEPRARLVVPVAVAAWGVAGML EGCGYQAEGGWGCLGYTLVREFSKDL
Uniprot No.

Target Background

Function
Probable acetyltransferase; may function as a transcription factor regulating coproporphyrinogen oxidase expression by binding to a promoter regulatory element.
Database Links

KEGG: mcf:102123243

UniGene: Mfa.2861

Protein Families
Camello family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is N-acetyltransferase 14 (NAT14) and why study it in Macaca fascicularis?

N-acetyltransferase 14 (NAT14) is an enzyme that catalyzes the transfer of acetyl groups from acetyl-CoA to various substrates, playing important roles in metabolism and detoxification pathways. Studying NAT14 in Macaca fascicularis is particularly valuable because cynomolgus macaques serve as an important non-human primate model in biomedical research, especially in areas such as drug metabolism, toxicology, and translational studies. Macaca fascicularis is extensively used in Singapore and other biomedical research hubs in Southeast Asia, making it an accessible model for studying protein function across different populations . The close phylogenetic relationship between macaques and humans enables more relevant translational findings compared to rodent models, particularly for proteins involved in xenobiotic metabolism like N-acetyltransferases.

How does recombinant Macaca fascicularis NAT14 differ from human NAT14?

While the search results don't provide specific sequence differences between Macaca fascicularis NAT14 and human NAT14, it's important to note that recombinant proteins from this species often share high sequence homology with their human counterparts. This homology makes them valuable research tools, but researchers should be aware of potential functional differences. When working with recombinant Macaca fascicularis proteins, examining sequence alignments and key functional domains is essential for understanding potential differences in substrate specificity, catalytic efficiency, and regulation. Similar to other recombinant proteins from this species, NAT14 would typically require thorough characterization to establish its functional relationship to the human ortholog.

What are the optimal storage conditions for recombinant Macaca fascicularis NAT14?

Based on standard protocols for similar recombinant proteins from Macaca fascicularis, optimal storage conditions for NAT14 would likely involve keeping the protein at -20°C for regular storage, or -80°C for extended storage periods . The protein would typically be maintained in a buffer containing a stabilizing agent such as glycerol (often at 50% concentration) in a Tris-based buffer optimized for maintaining protein stability and activity . For working with the protein, it's advisable to create small aliquots to avoid repeated freeze-thaw cycles, which can degrade protein quality and activity. Working aliquots can generally be stored at 4°C for up to one week . Always refer to manufacturer-specific recommendations, as optimal conditions can vary based on protein formulation and preparation method.

What considerations should be made when comparing NAT14 across different Macaca fascicularis populations?

When comparing NAT14 across different Macaca fascicularis populations, researchers should account for potential genetic and phenotypic variations that exist between geographic populations. As demonstrated with other characteristics in this species, significant phenotypic differences can exist between macaques from different geographic origins, such as those from Singapore, Vietnam, and Indonesia . These differences may extend to protein sequences and functional properties of enzymes like NAT14. Researchers should collect detailed information about the source of their Macaca fascicularis samples, including geographic origin, sex, age, and health status, as these factors can influence gene expression and protein function. Genome sequencing or targeted sequencing of the NAT14 gene from different populations can reveal polymorphisms that might affect enzyme activity or substrate specificity. When conducting comparative studies, it's important to standardize experimental conditions to ensure that observed differences are due to biological variation rather than methodological inconsistencies.

How should tissue-specific expression of NAT14 be analyzed in Macaca fascicularis?

Analysis of tissue-specific expression of NAT14 in Macaca fascicularis can be approached using multiple complementary methods. RNA-sequencing data, similar to that available for many tissues in the NCBI annotation report, can provide valuable insights into expression patterns across different tissues . Researchers should consider examining expression in metabolically active tissues such as liver, kidney, and gastrointestinal tract, as well as in specialized tissues relevant to their research question. Quantitative PCR can be used to validate RNA-seq findings and provide more sensitive detection of expression levels. At the protein level, western blotting with specific antibodies against Macaca fascicularis NAT14 can confirm expression in different tissues. Immunohistochemistry offers the advantage of revealing the cellular and subcellular localization of NAT14. For comprehensive analysis, researchers might consider creating a tissue expression profile similar to those generated for other genes in the NCBI Macaca fascicularis annotation, which includes data from diverse tissues including brain regions, digestive system, reproductive organs, and specialized sensory tissues .

What enzymatic assay methods are most suitable for characterizing recombinant Macaca fascicularis NAT14 activity?

For characterizing recombinant Macaca fascicularis NAT14 enzymatic activity, several complementary approaches should be considered. Spectrophotometric assays monitoring the formation of CoA-SH via reaction with DTNB (Ellman's reagent) provide a robust method for continuous monitoring of acetyltransferase activity. HPLC-based assays offer higher sensitivity and can directly quantify both substrates and products, enabling detailed kinetic analyses. For high-throughput screening of potential substrates or inhibitors, fluorescence-based assays using labeled substrates may be advantageous. Researchers should determine Michaelis-Menten kinetic parameters (Km, Vmax, kcat) under varying conditions (pH, temperature, ionic strength) to fully characterize the enzyme's catalytic properties. Substrate specificity profiles should be established by testing activity against a panel of potential substrates, including xenobiotics and endogenous compounds. Inhibition studies with known acetyltransferase inhibitors can provide insights into the active site structure and potential regulatory mechanisms. Additionally, temperature and pH stability profiles should be established to inform optimal assay conditions and storage protocols.

How can researchers develop and validate antibodies specific to Macaca fascicularis NAT14?

Developing antibodies specific to Macaca fascicularis NAT14 requires careful design and validation strategies. First, researchers should conduct sequence analysis to identify unique, surface-exposed epitopes that distinguish NAT14 from other acetyltransferases and show minimal cross-reactivity with human NAT14 (if species-specificity is desired). For monoclonal antibody development, recombinant protein or synthetic peptides corresponding to these unique regions can be used for immunization. Hybridoma screening should include rigorous specificity testing against related proteins. For polyclonal antibodies, peptide immunization followed by affinity purification against the immunizing peptide is recommended. Validation of antibodies should include western blotting against recombinant protein and tissue lysates from various macaque tissues, immunoprecipitation to confirm binding to native protein, and immunohistochemistry to verify tissue expression patterns . Epitope mapping can confirm the binding site and predict potential functional interference. Cross-reactivity testing against human and other primate NAT14 proteins should be performed to establish species specificity. Finally, functional validation through activity assays can determine whether the antibody modulates enzyme activity, which could be useful for inhibition studies.

How should researchers interpret differences in NAT14 activity between Macaca fascicularis from different geographic origins?

When interpreting differences in NAT14 activity between Macaca fascicularis from different geographic origins, researchers must consider both genetic and environmental factors. Phenotypic variations between populations from different regions (such as Singapore, Vietnam, and Indonesia) have been documented for other traits , and these may extend to enzyme activities including NAT14. Geographic variations could reflect evolutionary adaptations to different environmental toxins or diets. Researchers should sequence the NAT14 gene from individuals of different origins to identify polymorphisms that might explain activity differences. It's important to control for confounding variables such as age, sex, health status, and diet when comparing populations. Statistical analysis should include appropriate corrections for multiple comparisons and population stratification. When significant differences are observed, researchers should consider the ecological and evolutionary context of these populations to develop hypotheses about selective pressures that might have shaped NAT14 function. For translational studies, researchers should clearly report the geographic origin of the macaques used and avoid generalizing findings from one population to all Macaca fascicularis.

What are the key considerations when comparing in vitro NAT14 activity with in vivo metabolism data?

Comparing in vitro NAT14 activity with in vivo metabolism data requires careful consideration of several factors that might affect the translation between systems. In vitro conditions rarely replicate the complex cellular environment, including cofactor availability, compartmentalization, and the presence of competing enzymes or regulatory proteins. Researchers should account for differences in substrate concentrations between in vitro assays (often using saturating concentrations) and physiological conditions (where substrates may be at sub-Km levels). Pharmacokinetic factors such as absorption, distribution, and clearance significantly affect substrate availability to NAT14 in vivo but are absent in vitro. Tissue-specific expression patterns of NAT14 in Macaca fascicularis should be considered when interpreting whole-organism metabolism data . For better correlation, researchers can employ scaling methods based on enzyme abundance in relevant tissues and physiologically-based pharmacokinetic (PBPK) modeling. Whenever possible, ex vivo systems like tissue slices or primary hepatocytes can provide an intermediate level of complexity between purified enzyme studies and whole-animal experiments. Finally, researchers should be aware that post-translational modifications or interacting proteins present in vivo might affect NAT14 activity in ways not captured by recombinant protein studies.

How can researchers address data inconsistencies when comparing NAT14 function across different experimental platforms?

Addressing data inconsistencies when comparing NAT14 function across different experimental platforms requires systematic troubleshooting and standardization approaches. First, researchers should thoroughly document and compare all experimental conditions, including buffer composition, pH, temperature, substrate concentrations, and protein preparation methods. Differences in protein constructs (full-length versus truncated, presence of tags) can significantly impact enzyme function and should be explicitly considered. For recombinant proteins, different expression systems (bacterial, insect, mammalian) may yield proteins with different post-translational modifications affecting activity. To address these issues, researchers should conduct parallel experiments with standardized protocols and positive controls. Reference substrates with well-characterized kinetics should be included across all platforms for calibration. Inter-laboratory validation studies can help identify systematic biases in particular experimental setups. Statistical approaches such as Bland-Altman plots can quantify the agreement between methods, while multivariate analysis may reveal patterns in the discrepancies. Bayesian approaches that incorporate prior knowledge can be particularly useful when integrating heterogeneous data sources. Finally, reporting standards should include detailed methodological descriptions and raw data sharing to enable other researchers to identify potential sources of inconsistencies.

What methodologies can be used to study the role of NAT14 in Macaca fascicularis disease models?

Studying the role of NAT14 in Macaca fascicularis disease models requires integrated approaches spanning genetic, molecular, and physiological techniques. For genetic manipulation, CRISPR/Cas9 technology can be used to generate NAT14 knockdown or knockout models, though ethical and practical considerations limit widespread application in non-human primates. Alternatively, pharmacological inhibition using selective NAT14 inhibitors can provide insights into enzyme function in disease contexts. RNA interference (siRNA or shRNA) delivered via viral vectors offers another approach for tissue-specific knockdown. Physiological studies should include comprehensive phenotyping with particular attention to systems where NAT14 is highly expressed. Disease-specific biomarkers and functional assays relevant to the model (e.g., neurobehavioral tests for neurological disorders, glucose tolerance tests for metabolic disorders) should be incorporated. Molecular profiling using transcriptomics, proteomics, and metabolomics can reveal downstream effects of NAT14 modulation. For mechanistic insights, stable isotope-labeled substrates can track metabolic flux through NAT14-dependent pathways. Ex vivo studies using tissues from disease models can bridge in vitro and in vivo findings. Finally, translational validation through comparison with human patient samples or data can establish the relevance of findings from Macaca fascicularis models to human disease.

How can researchers overcome solubility and stability issues with recombinant Macaca fascicularis NAT14?

To overcome solubility and stability issues with recombinant Macaca fascicularis NAT14, researchers can implement several strategic approaches. Expression optimization should include testing different fusion partners (MBP, SUMO, GST) known to enhance solubility while maintaining a cleavage site for tag removal. Expression temperature modulation (typically lowering to 16-20°C) can reduce inclusion body formation by slowing protein synthesis and allowing proper folding. For buffer optimization, high-throughput screening of different buffer conditions (varying pH, ionic strength, and additives) can identify stabilizing formulations. Specific additives to consider include glycerol (typically 10-50%) , reducing agents (DTT, β-mercaptoethanol), and specific cofactors or substrate analogs that might stabilize the native conformation. If the protein remains prone to aggregation, size exclusion chromatography can be used to isolate monodisperse fractions. For long-term storage, flash-freezing small aliquots in liquid nitrogen and storing at -80°C minimizes degradation from repeated freeze-thaw cycles . Protein engineering approaches, such as removing flexible regions or introducing stabilizing mutations based on homology models, can improve intrinsic stability. If expression in E. coli remains challenging, alternative expression systems such as insect cells or mammalian cells might yield more soluble protein, especially if post-translational modifications are important for stability.

What strategies can be employed to improve the specificity of NAT14 activity assays?

Improving the specificity of NAT14 activity assays requires careful consideration of assay design and validation. Substrate selection is critical—researchers should conduct preliminary screening to identify substrates with high specificity for NAT14 over other acetyltransferases. Developing NAT14-selective substrates with modified chemical structures that retain reactivity with NAT14 but not with related enzymes can significantly enhance specificity. For antibody-based detection methods, extensive validation of antibody specificity is essential, including testing against other NAT family members . Control experiments should include pre-incubation with selective inhibitors to confirm that measured activity is attributable to NAT14. Kinetic analysis comparing activity patterns with known NAT14 inhibitors can provide additional validation. For recombinant enzyme studies, parallel assays with related NAT enzymes can establish relative selectivity of substrates and conditions. Knockout or knockdown validation using tissues or cells where NAT14 has been selectively depleted provides the most rigorous confirmation of assay specificity. For mass spectrometry-based assays, multiple reaction monitoring (MRM) targeting specific peptides or reaction products can greatly enhance selectivity. Statistical approaches such as principal component analysis of activity profiles across multiple substrates and conditions can help distinguish NAT14-specific activity from background or non-specific reactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.