The NDUFA13 gene encodes a protein that is a subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) . Complex I is essential for transferring electrons from NADH to the respiratory chain . The protein encoded by NDUFA13 is required for Complex I assembly and its electron transfer activity .
Aliases:
External IDs:
NDUFA13 is an accessory subunit of Complex I, believed not to be directly involved in catalysis . The immediate electron acceptor for Complex I is ubiquinone . NDUFA13 is involved in interferon/all-trans-retinoic acid (IFN/RA)-induced cell death, and its apoptotic activity is inhibited by interaction with viral IRF1 . It prevents the transactivation of STAT3 target genes and may regulate intestinal epithelial cell responses to microbes .
Diseases associated with NDUFA13 include Mitochondrial Complex I Deficiency, Nuclear Type 28, and Thyroid Carcinoma, Hurthle Cell . It participates in pathways such as respiratory electron transport, ATP synthesis by chemiosmotic coupling, heat production by uncoupling proteins, and Complex I biogenesis .
Mitochondrial Complex I Deficiency: Biallelic variants in NDUFA13 are associated with mitochondrial Complex I deficiency. A study reported on eight individuals from seven independent families with missense and loss-of-function biallelic NDUFA13 variants. Complex I activity was decreased, and complex IV activity was increased in patient-derived skin fibroblasts, with undetectable NDUFA13 protein levels .
Protection Against Hypoxia/Reoxygenation-Induced Cell Injury: Research indicates that moderate downregulation of NDUFA13 can protect against hypoxia/reoxygenation-induced cell injury. In H9C2 cells, a moderate decrease in NDUFA13 expression was associated with a decrease in TUNEL-positive cells after exposure to hypoxia and reoxygenation .
Protection Against I/R Injury: Studies have shown that moderate NDUFA13 downregulation protects the heart from ischemia-reperfusion (I/R) injury. A significant decrease in infarct size was observed in mice with cardiac-specific NDUFA13 downregulation compared to control mice .
Recombinant full-length Macaca fascicularis NDUFA13 protein with an N-terminal His tag, expressed in E. coli, is available for research purposes .
| Category | Description |
|---|---|
| Species | Macaca fascicularis |
| Source | E. coli |
| Tag | His |
| Protein Length | Full Length (1-163) |
| Form | Lyophilized powder |
| Amino Acid Sequence | MAVAVCHFRLGPEVWNTASMEMPKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLVYGHWSIMKWNRERRRLQIEDFEARIALMPLFQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEETIHANYGFMWYT |
| Purity | Greater than 90% as determined by SDS-PAGE |
| Storage | Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles. |
| Storage Buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Recombinant Macaca fascicularis NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (NDUFA13) is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is not believed to be directly involved in catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone thought to be the immediate electron acceptor. NDUFA13 plays a role in interferon/all-trans-retinoic acid (IFN/RA)-induced cell death, an apoptotic activity inhibited by interaction with viral IRF1. It also prevents the transactivation of STAT3 target genes and may participate in CARD15-mediated innate mucosal responses, regulating intestinal epithelial cell reactions to microbes.
KEGG: mcf:101926508
UniGene: Mfa.8623
NDUFA13 serves several distinct functions in mitochondrial physiology:
Respiratory chain component: As an accessory subunit of mitochondrial Complex I, NDUFA13 participates in the transfer of electrons from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor .
Complex I assembly: Though not directly involved in catalysis, NDUFA13 is required for proper assembly and electron transfer activity of Complex I .
Cell death regulation: NDUFA13 is involved in interferon/all-trans-retinoic acid (IFN/RA) induced cell death pathways . This apoptotic activity can be inhibited by interaction with viral IRF1 .
STAT3 signaling inhibition: NDUFA13 prevents the transactivation of STAT3 target genes, potentially functioning as a tumor suppressor .
Innate immune response: It may play a role in CARD15-mediated innate mucosal responses and regulate intestinal epithelial cell responses to microbes .
The multifunctional nature of NDUFA13 makes it an important target for studies in various physiological and pathological contexts beyond its role in mitochondrial respiration.
NDUFA13 occupies a unique position within Complex I that directly influences its function:
Structural position: NDUFA13 is located at the "heel" position of mitochondrial Complex I, with its transmembrane helix inserted obliquely into the hydrophobic chains ND1 and ND2 .
Membrane interaction: The protein contains a transmembrane helix (TMH) structure that can penetrate both Iα and Iλ, two important structures within Complex I . This makes NDUFA13 the only protein known to have this specific structural arrangement.
Proximity to electron transport components: The first 33 amino acids of NDUFA13 extend along the dorsal side of the CoQ binding chamber after penetrating the inner membrane and run parallel to the last three FeS clusters (N2, N6b, and N6a), positioned approximately 31 Å apart .
Potential channel formation: The unique location and structure suggest NDUFA13 may form a channel within Complex I that interconnects the matrix with the membrane interstitium .
This strategic positioning has significant functional implications:
It may allow NDUFA13 to act as a "guardian" that gauges electron flow across the electron transfer chain
Its location near FeS clusters with lower electrochemical potentials creates a unique profile for ROS generation when NDUFA13 is down-regulated
This positioning explains how partial loss of NDUFA13 can create an electron leak resulting in H₂O₂ generation without affecting membrane potential
Several expression systems have been validated for recombinant Macaca fascicularis NDUFA13 production, each with distinct advantages:
| Expression System | Advantages | Considerations | Applications |
|---|---|---|---|
| E. coli | High yield, cost-effective, rapid production | May lack post-translational modifications, potential for inclusion bodies | Structural studies, antibody production |
| Mammalian cells (HEK293) | Native-like post-translational modifications, proper folding | Higher cost, longer production time | Functional studies, protein-protein interaction assays |
| Baculovirus | High expression levels, eukaryotic processing | Moderate complexity, intermediate cost | Large-scale production, functional studies |
| Yeast | Cost-effective eukaryotic system | May have different glycosylation patterns | Alternative to mammalian expression |
| In vitro cell-free system | Rapid production, avoids toxicity issues | Lower yields, higher cost | Quick screening, toxic protein expression |
For optimal results, consider the following approach:
Define your experimental requirements (protein purity, functional activity, yield)
For structural studies requiring high yields without emphasis on post-translational modifications, E. coli systems are recommended
For functional studies where proper folding and post-translational modifications are critical, mammalian HEK293 cells provide the most physiologically relevant environment
Include appropriate tags (His, Avi, Fc, GST) based on downstream applications and purification strategies
The choice of expression system should align with the specific research question being addressed.
Validating the functionality of recombinant NDUFA13 requires a multi-faceted approach:
Biochemical activity assessment:
Structural integrity verification:
Circular dichroism to confirm proper secondary structure formation
Limited proteolysis to assess folding quality
Size exclusion chromatography to verify monomeric state and absence of aggregation
Functional complementation assays:
Restore function in NDUFA13-depleted systems:
Protein-protein interaction assessment:
Cell-based functional assays:
The most conclusive validation combines multiple approaches, particularly matching biochemical activity with cellular functional outcomes.
Designing effective knockdown/knockout studies for NDUFA13 requires careful consideration of several factors:
Model selection based on research question:
For cardiac function studies: Cardiac-specific tamoxifen-inducible NDUFA13 knockout mice have proven effective
For cellular studies: NMCMs from NDUFA13ᶠˡᵒˣ/ᶠˡᵒˣ mice transfected with adenovirus containing Myh6-Cre provide a controlled system
For partial knockdown: Heterozygous knockout (cHet) mice exhibit normal cardiac morphology and function in the basal state but show differential responses to stress
Targeting strategy:
Validation approaches:
Functional assessment methods:
Rescue experiments:
A well-designed example from the literature demonstrates the effectiveness of cardiac-specific heterozygous knockout mice which revealed that moderate down-regulation of NDUFA13 creates a leak within complex I, resulting in a mild increase in cytoplasmic H₂O₂ that activates protective signaling pathways during ischemia-reperfusion injury .
NDUFA13 modulation creates a specific ROS generation profile with significant implications for cardioprotection:
ROS profile with NDUFA13 down-regulation:
Moderate down-regulation of NDUFA13 causes a leak within Complex I that specifically increases hydrogen peroxide (H₂O₂) production without affecting superoxide levels at baseline
This H₂O₂ increase is localized primarily to the cytosol rather than the mitochondrial matrix
The ROS generation occurs without disruption of the mitochondrial membrane potential (MMP)
Mechanism of electron leak:
NDUFA13's unique position near FeS clusters with lower electrochemical potentials creates a "spillhole" when partially absent
This position allows electrons to react with oxygen to form H₂O₂ rather than superoxide
The reduction potential of coenzyme Q (+0.113V) is insufficient for producing superoxide (O₂/- O₂⁻ -0.13V) but adequate for H₂O₂ production (O₂/H₂O₂ +0.70V)
Cardioprotective signaling pathway:
Functional outcomes in ischemia-reperfusion (I/R) injury:
Cardiac-specific heterozygous NDUFA13 knockout mice show:
This represents a novel mechanism of cardioprotection where mild, localized ROS increase primes protective signaling pathways to prevent the damaging ROS burst during stress. The findings suggest that targeted NDUFA13 modulation could be a therapeutic strategy for conditions involving oxidative stress and ischemic injury.
The relationship between NDUFA13 and STAT3 signaling represents a critical intersection between mitochondrial function and immune regulation:
Direct inhibitory interaction:
Impact on immune signaling pathways:
Role in inflammatory responses:
Connection to interferon signaling:
NDUFA13 is involved in interferon/all-trans-retinoic acid (IFN/RA) induced cell death
This apoptotic activity can be inhibited by interaction with viral IRF1 , suggesting a role in antiviral responses
The gene was originally identified as "gene associated with retinoic and interferon-induced mortality 19 protein" (GRIM-19)
Dual subcellular localization and function:
While primarily recognized as a mitochondrial protein, NDUFA13 also functions in non-mitochondrial locations to regulate STAT3
This dual localization allows NDUFA13 to serve as a link between metabolic state and immune signaling
Understanding this relationship provides insight into how mitochondrial proteins can directly influence nuclear gene expression and immune responses, offering potential therapeutic targets for inflammatory conditions and cancer.
Structural analysis of NDUFA13 provides valuable insights for developing targeted approaches to address mitochondrial dysfunction:
Critical structural features with functional relevance:
The N-terminal hydrophobic domain forms an alpha helix spanning the inner mitochondrial membrane
The C-terminal hydrophilic domain interacts with globular subunits of Complex I
The highly conserved two-domain structure suggests critical functional importance
The TMH segment penetrates both Iα and Iλ structures of Complex I, creating a unique positioning
The first 33 amino acids extend along the CoQ binding chamber and run parallel to FeS clusters
Structure-guided targeting strategies:
Domain-specific modulation: Target the transmembrane domain to affect anchoring without disrupting electron transfer
Interface targeting: Design molecules that modify NDUFA13's interaction with ND1 and ND2 subunits
Electron leak control: Develop compounds that can mimic the "spillhole" effect of partial NDUFA13 deficiency to produce cardioprotective H₂O₂ levels
Conformation-selective compounds: Create molecules that stabilize specific conformations of NDUFA13 to modulate its activity
Potential therapeutic applications:
Cardioprotection: Compounds mimicking moderate NDUFA13 down-regulation could provide protection against ischemia-reperfusion injury
Cancer therapy: Enhancing NDUFA13 function might restore STAT3 inhibition in tumors where this pathway is dysregulated
Neurodegenerative diseases: Modulating the electron leak properties could mitigate oxidative damage in conditions like Alzheimer's and Parkinson's diseases
Metabolic disorders: Targeted approaches affecting Complex I efficiency could influence energy metabolism
Structure-based screening approaches:
Virtual screening against the NDUFA13-ND1/ND2 interface
Fragment-based drug discovery focusing on the transmembrane helix
Peptide mimetics based on critical interaction domains
Allosteric modulators that affect NDUFA13 conformation
Studying NDUFA13 interactions with the respiratory chain presents several methodological challenges that require specific approaches:
Maintaining native membrane environment:
Challenge: NDUFA13 is a transmembrane protein embedded in the complex lipid environment of the inner mitochondrial membrane.
Solution: Use nanodisc technology to reconstitute NDUFA13 and interacting partners in lipid bilayers that mimic the native environment. Alternatively, employ native electrophoresis methods like Blue Native PAGE to preserve complex integrity .
Complex I size and complexity:
Challenge: Complex I contains ~45 subunits in mammals, making it difficult to study specific subunit interactions.
Solution: Utilize proximity labeling methods such as BioID or APEX2 to identify proteins in close proximity to NDUFA13 within the intact complex. Cryo-electron microscopy has also proven valuable for resolving subunit arrangements .
Functional redundancy and compensation:
Challenge: Complete knockout of NDUFA13 may trigger compensatory mechanisms that mask true functions.
Solution: Employ inducible and partial knockdown systems as demonstrated in cardiac-specific heterozygous knockout mice . Time-course studies after induction can help distinguish direct effects from compensatory responses.
Distinguishing NDUFA13's respiratory vs. non-respiratory functions:
Challenge: NDUFA13 has dual roles in Complex I and STAT3 signaling that are difficult to separate.
Solution: Design mutants that selectively disrupt specific interactions (e.g., STAT3 binding) while preserving others. Domain-swap experiments between species with differential activity can help identify functional regions .
Measuring subtle changes in electron flow:
Challenge: The "spillhole" electron leak may produce subtle changes difficult to detect with standard methods.
Solution: High-resolution respirometry using Oxygraph-2k can detect fine changes in oxygen consumption . Site-specific ROS detection using targeted probes like cyto-HyPer and mito-HyPer provides compartment-specific information .
Protein stability and solubility:
Challenge: Membrane proteins often aggregate when removed from their native environment.
Solution: Use mild detergents like digitonin or lauryl maltose neopentyl glycol (LMNG) for extraction. For recombinant expression, consider fusion partners that enhance solubility while maintaining function.
Addressing these challenges requires combining biochemical, structural, and cell biological approaches to build a comprehensive understanding of NDUFA13's complex interactions within the respiratory chain.
Distinguishing between the respiratory and non-respiratory functions of NDUFA13 requires specialized experimental approaches:
Domain-specific mutational analysis:
Create targeted mutations that specifically disrupt either respiratory or non-respiratory functions
N-terminal hydrophobic domain mutations may primarily affect Complex I integration
C-terminal modifications may preferentially impact STAT3 binding
Validate mutants by assessing their:
Localization to mitochondria
Integration into Complex I
Ability to bind STAT3
Effect on electron transfer
Subcellular localization studies:
Use fractionation techniques to separate mitochondrial and cytosolic pools of NDUFA13
Employ immunofluorescence with high-resolution microscopy to visualize distribution patterns
Create fusion proteins with compartment-specific targeting sequences to force localization to specific cellular regions
Compare functions of differentially localized NDUFA13 variants
Temporal separation of functions:
Acute vs. chronic manipulation of NDUFA13 levels may reveal primary vs. secondary effects
Immediate responses are more likely related to direct functions
Time-course studies tracking both respiratory and STAT3-related outcomes can separate kinetically distinct processes
Pathway-specific inhibitors:
Use specific inhibitors of Complex I (e.g., rotenone) to block respiratory functions
Apply STAT3 pathway inhibitors to block non-respiratory signaling
Assess how these interventions affect NDUFA13-dependent phenotypes
Complementation approaches:
In NDUFA13-deficient systems, introduce:
Mitochondria-only targeted NDUFA13
Cytosol-only targeted NDUFA13
Full-length NDUFA13
Compare rescue effects on:
Complex I assembly and activity
ROS generation profiles
STAT3 signaling
Cell survival during stress
Interactome analysis under different conditions:
Compare NDUFA13 interaction partners under:
Basal conditions
Oxidative stress
Cytokine stimulation
Use proximity labeling methods (BioID, APEX) combined with mass spectrometry to identify context-specific interactors
These approaches collectively provide a framework for dissecting the multifunctional nature of NDUFA13 and understanding how its diverse roles are coordinated in different cellular contexts.
Translating findings from Macaca fascicularis NDUFA13 to human applications requires careful consideration of several factors:
Sequence and structural homology assessment:
While Macaca fascicularis NDUFA13 (163 aa) is longer than human NDUFA13 (144 aa), they share high sequence homology
Conduct detailed sequence alignment to identify:
Conserved functional domains
Species-specific variations in key regions
Potential differences in post-translational modification sites
Structural modeling should confirm similar folding patterns and interaction interfaces
Functional conservation verification:
Compare biochemical properties:
| Property | Macaca fascicularis | Human | Implications |
|---|---|---|---|
| Complex I integration | Present | Present | Conserved basic function |
| STAT3 binding | Present | Present | Conserved signaling role |
| Apoptosis regulation | Present | Present | Conserved cell death control |
| ROS modulation | H₂O₂ generation when downregulated | Similar pattern expected | Potential conserved mechanism |
Validate key findings in both species using parallel experimental systems
Differential expression and regulation:
Compare tissue-specific expression patterns between species
Assess regulatory mechanisms controlling NDUFA13 expression:
Pharmacological response differences:
Test compounds that modulate NDUFA13 in both species' cell models
Consider species-specific metabolic differences that might affect drug efficacy
Validate biomarkers of NDUFA13 modulation across species
Disease relevance translation:
Compare NDUFA13 alterations in comparable disease states:
Cardiovascular conditions
Neurodegenerative diseases
Cancer
Assess whether disease-associated mutations affect similar pathways
Experimental system considerations:
When possible, conduct parallel experiments in:
Recombinant protein systems from both species
Cell lines derived from both species
Tissue samples when available
Consider using humanized models to bridge the translation gap
Ethical and practical considerations:
Macaca fascicularis provides a valuable non-human primate model with greater translational relevance than rodent models
Balance the ethical use of primate models with the scientific need for translational validation
Consider emerging alternatives like organoids or advanced in vitro systems that recapitulate human physiology
By systematically addressing these considerations, researchers can maximize the translational value of findings from Macaca fascicularis NDUFA13 studies while acknowledging and accounting for species-specific differences.
NDUFA13's involvement in metabolic diseases presents several promising research directions:
Connection to non-alcoholic fatty liver disease (NAFLD):
NDUFA13 is implicated in the NAFLD pathway according to pathway analysis
Research approaches:
Investigate NDUFA13 expression in liver biopsies from NAFLD patients
Develop hepatocyte-specific NDUFA13 knockout models to assess metabolic consequences
Examine how lipid accumulation affects NDUFA13 function and vice versa
Explore the relationship between NDUFA13-mediated ROS production and hepatic insulin resistance
Role in diabetes and high glucose conditions:
High glucose culture downregulates NDUFA13 expression in cardiomyocytes
Metformin prevents this downregulation, suggesting a potential mechanism for its beneficial effects
Research approaches:
Investigate tissue-specific NDUFA13 expression changes in diabetic models
Examine how NDUFA13 downregulation affects mitochondrial function in pancreatic β-cells
Explore the relationship between NDUFA13, ROS generation, and insulin signaling
Test whether targeted NDUFA13 modulation could improve metabolic parameters in diabetic models
Interaction with metabolic signaling pathways:
NDUFA13 is associated with PKLR (pyruvate kinase, liver and RBC) in metabolic pathway analysis
Research approaches:
Investigate how NDUFA13 modulates or responds to key metabolic regulators like AMPK
Examine cross-talk between mitochondrial function and adipokine signaling
Assess how nutrient availability affects NDUFA13 expression and function
Study post-translational modifications of NDUFA13 in response to metabolic states
Therapeutic targeting approaches:
Develop compounds that stabilize NDUFA13 in conditions where it's downregulated
Explore whether the cardioprotective effects of moderate NDUFA13 downregulation extend to metabolic tissue protection
Investigate combination approaches targeting NDUFA13 alongside established metabolic regulators
Novel methodological approaches:
Metabolic flux analysis to determine how NDUFA13 modulation affects substrate utilization
In vivo imaging of tissue-specific ROS generation in NDUFA13 mutant models
Single-cell transcriptomics to identify cell populations most affected by NDUFA13 dysfunction
Integration of multi-omics data to place NDUFA13 in the broader context of metabolic regulation
The relationship between mitochondrial function and metabolic disease makes NDUFA13 a particularly interesting target, especially considering its dual role in respiratory chain function and signaling pathway regulation.
NDUFA13's potential role in neurodegenerative diseases presents an important research frontier:
Connection to established neurodegenerative pathways:
Potential mechanistic contributions:
Mitochondrial dysfunction: As a Complex I component, NDUFA13 alterations may contribute to the well-established mitochondrial defects in neurodegenerative diseases
Oxidative stress regulation: The specific ROS profile generated by NDUFA13 modulation could influence neuronal survival
Apoptotic regulation: NDUFA13's role in cell death pathways is relevant to neurodegeneration
STAT3 signaling: NDUFA13 inhibits STAT3, which has neuroprotective functions in some contexts
Most informative experimental models:
Cellular models:
Primary neurons with NDUFA13 knockdown/overexpression
Human iPSC-derived neurons from patients with neurodegenerative diseases
Microfluidic chambers to study NDUFA13's role in axonal transport and health
Organotypic brain slice cultures to maintain neural circuit integrity
Animal models:
Neuron-specific conditional NDUFA13 knockout mice
Models combining NDUFA13 modulation with established neurodegenerative mutations
Non-human primate models including Macaca fascicularis for translational studies
Drosophila models for high-throughput genetic interaction screening
Human studies:
Post-mortem brain tissue analysis for NDUFA13 expression/localization changes
Genetic association studies examining NDUFA13 variants in patient cohorts
Biomarker development based on NDUFA13 pathway activation
Key experimental approaches:
Functional assessment:
High-resolution respirometry in isolated brain mitochondria
In vivo imaging of neuronal ROS using genetically encoded sensors
Electrophysiological recordings to assess neuronal function
Behavioral testing in animal models
Molecular analysis:
Proteomic analysis of NDUFA13 interactome in neural tissues
Examination of post-translational modifications in disease states
Subcellular localization studies in affected neurons
Single-cell transcriptomics to identify vulnerable neuronal populations
Therapeutic exploration:
Test whether the cardioprotective effects of moderate NDUFA13 downregulation extend to neuroprotection
Develop compounds that can modulate NDUFA13 function in the CNS
Explore combination approaches targeting both NDUFA13 and established neurodegenerative pathways
NDUFA13's involvement in multiple cellular processes relevant to neurodegeneration makes it an intriguing target for understanding and potentially treating these devastating diseases.
Advanced imaging techniques offer powerful approaches to understanding NDUFA13 dynamics:
Super-resolution microscopy applications:
STORM/PALM: Achieve ~20nm resolution to visualize NDUFA13 within Complex I architecture
STED microscopy: Examine NDUFA13 distribution relative to other mitochondrial structures
SIM (Structured Illumination Microscopy): Track NDUFA13 reorganization during mitochondrial stress
Expansion microscopy: Physically expand specimens to resolve NDUFA13 positioning within Complex I
Live-cell imaging approaches:
NDUFA13-fluorescent protein fusions: Track dynamics in real-time
Split fluorescent protein complementation: Visualize NDUFA13 interactions with binding partners
FRET sensors: Detect conformational changes or protein-protein interactions
Targeted biosensors: Monitor local ROS production near NDUFA13 using genetically-encoded redox sensors
Multi-modal imaging combinations:
Correlative light and electron microscopy (CLEM): Link NDUFA13 fluorescence with ultrastructural features
Functional imaging with electrophysiology: Correlate NDUFA13 dynamics with mitochondrial membrane potential
Label-free imaging with fluorescence: Combine techniques like Raman microscopy with fluorescent labeling
Advanced tissue imaging applications:
Tissue clearing techniques: Visualize NDUFA13 distribution in intact organs
Intravital microscopy: Observe NDUFA13 dynamics in living animals
Light-sheet microscopy: Image large tissue volumes with minimal phototoxicity
Multi-photon microscopy: Achieve deep tissue imaging with reduced photodamage
Dynamic tracking methodologies:
Single-particle tracking: Follow individual NDUFA13-containing complexes
Fluorescence recovery after photobleaching (FRAP): Measure NDUFA13 mobility and exchange rates
Photoactivation/photoconversion: Track specific subpopulations of NDUFA13
Optogenetic approaches: Manipulate NDUFA13 function with light while imaging responses
Quantitative image analysis approaches:
Machine learning algorithms: Automatically identify and track NDUFA13-containing structures
Computational modeling: Integrate imaging data with structural information
Spatial statistics: Analyze NDUFA13 distribution patterns and co-localization
4D analysis: Track changes in NDUFA13 dynamics over time in three dimensions