Recombinant Macaca fascicularis NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (NDUFA13)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Macaca fascicularis NADH Dehydrogenase [Ubiquinone] 1 Alpha Subcomplex Subunit 13 (NDUFA13)

The NDUFA13 gene encodes a protein that is a subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) . Complex I is essential for transferring electrons from NADH to the respiratory chain . The protein encoded by NDUFA13 is required for Complex I assembly and its electron transfer activity .

Aliases:

  • NADH Dehydrogenase [Ubiquinone] 1 Alpha Subcomplex Subunit 13

  • NADH Dehydrogenase (Ubiquinone) 1 Alpha Subcomplex, 13

  • NADH-Ubiquinone Oxidoreductase B16.6 Subunit

  • Cell Death Regulatory Protein GRIM-19

  • Complex I B16.6 Subunit

  • Complex I-B16.6

  • CI-B16.6

  • Cell Death-Regulatory Protein GRIM19

  • MC1DN28

External IDs:

  • HGNC: 17194

  • NCBI Gene: 51079

  • Ensembl: ENSG00000186010

  • OMIM®: 609435

  • UniProtKB/Swiss-Prot: Q9P0J0

Function and Characteristics

NDUFA13 is an accessory subunit of Complex I, believed not to be directly involved in catalysis . The immediate electron acceptor for Complex I is ubiquinone . NDUFA13 is involved in interferon/all-trans-retinoic acid (IFN/RA)-induced cell death, and its apoptotic activity is inhibited by interaction with viral IRF1 . It prevents the transactivation of STAT3 target genes and may regulate intestinal epithelial cell responses to microbes .

Diseases and Pathways

Diseases associated with NDUFA13 include Mitochondrial Complex I Deficiency, Nuclear Type 28, and Thyroid Carcinoma, Hurthle Cell . It participates in pathways such as respiratory electron transport, ATP synthesis by chemiosmotic coupling, heat production by uncoupling proteins, and Complex I biogenesis .

Research Findings

  • Mitochondrial Complex I Deficiency: Biallelic variants in NDUFA13 are associated with mitochondrial Complex I deficiency. A study reported on eight individuals from seven independent families with missense and loss-of-function biallelic NDUFA13 variants. Complex I activity was decreased, and complex IV activity was increased in patient-derived skin fibroblasts, with undetectable NDUFA13 protein levels .

  • Protection Against Hypoxia/Reoxygenation-Induced Cell Injury: Research indicates that moderate downregulation of NDUFA13 can protect against hypoxia/reoxygenation-induced cell injury. In H9C2 cells, a moderate decrease in NDUFA13 expression was associated with a decrease in TUNEL-positive cells after exposure to hypoxia and reoxygenation .

  • Protection Against I/R Injury: Studies have shown that moderate NDUFA13 downregulation protects the heart from ischemia-reperfusion (I/R) injury. A significant decrease in infarct size was observed in mice with cardiac-specific NDUFA13 downregulation compared to control mice .

Protein Information

Recombinant full-length Macaca fascicularis NDUFA13 protein with an N-terminal His tag, expressed in E. coli, is available for research purposes .

Table: Recombinant Protein Details

CategoryDescription
SpeciesMacaca fascicularis
SourceE. coli
TagHis
Protein LengthFull Length (1-163)
FormLyophilized powder
Amino Acid SequenceMAVAVCHFRLGPEVWNTASMEMPKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLVYGHWSIMKWNRERRRLQIEDFEARIALMPLFQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEETIHANYGFMWYT
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
NDUFA13; QtsA-18051; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13; Complex I-B16.6; CI-B16.6; NADH-ubiquinone oxidoreductase B16.6 subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-163
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
Target Protein Sequence
MAVAVCHFRLGPEVWNTASMEMPKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIG TLVYGHWSIMKWNRERRRLQIEDFEARIALMPLFQAETDRRTLQMLRENLEEEAIIMKDV PDWKVGESVFHTTRWVPPLIGELYGLRTTEETIHANYGFMWYT
Uniprot No.

Target Background

Function

Recombinant Macaca fascicularis NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (NDUFA13) is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is not believed to be directly involved in catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone thought to be the immediate electron acceptor. NDUFA13 plays a role in interferon/all-trans-retinoic acid (IFN/RA)-induced cell death, an apoptotic activity inhibited by interaction with viral IRF1. It also prevents the transactivation of STAT3 target genes and may participate in CARD15-mediated innate mucosal responses, regulating intestinal epithelial cell reactions to microbes.

Database Links

KEGG: mcf:101926508

UniGene: Mfa.8623

Protein Families
Complex I NDUFA13 subunit family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side. Nucleus.

Q&A

What are the primary functions of NDUFA13 in mitochondrial physiology?

NDUFA13 serves several distinct functions in mitochondrial physiology:

  • Respiratory chain component: As an accessory subunit of mitochondrial Complex I, NDUFA13 participates in the transfer of electrons from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor .

  • Complex I assembly: Though not directly involved in catalysis, NDUFA13 is required for proper assembly and electron transfer activity of Complex I .

  • Cell death regulation: NDUFA13 is involved in interferon/all-trans-retinoic acid (IFN/RA) induced cell death pathways . This apoptotic activity can be inhibited by interaction with viral IRF1 .

  • STAT3 signaling inhibition: NDUFA13 prevents the transactivation of STAT3 target genes, potentially functioning as a tumor suppressor .

  • Innate immune response: It may play a role in CARD15-mediated innate mucosal responses and regulate intestinal epithelial cell responses to microbes .

The multifunctional nature of NDUFA13 makes it an important target for studies in various physiological and pathological contexts beyond its role in mitochondrial respiration.

How is NDUFA13 positioned within Complex I and what implications does this have for its function?

NDUFA13 occupies a unique position within Complex I that directly influences its function:

  • Structural position: NDUFA13 is located at the "heel" position of mitochondrial Complex I, with its transmembrane helix inserted obliquely into the hydrophobic chains ND1 and ND2 .

  • Membrane interaction: The protein contains a transmembrane helix (TMH) structure that can penetrate both Iα and Iλ, two important structures within Complex I . This makes NDUFA13 the only protein known to have this specific structural arrangement.

  • Proximity to electron transport components: The first 33 amino acids of NDUFA13 extend along the dorsal side of the CoQ binding chamber after penetrating the inner membrane and run parallel to the last three FeS clusters (N2, N6b, and N6a), positioned approximately 31 Å apart .

  • Potential channel formation: The unique location and structure suggest NDUFA13 may form a channel within Complex I that interconnects the matrix with the membrane interstitium .

This strategic positioning has significant functional implications:

  • It may allow NDUFA13 to act as a "guardian" that gauges electron flow across the electron transfer chain

  • Its location near FeS clusters with lower electrochemical potentials creates a unique profile for ROS generation when NDUFA13 is down-regulated

  • This positioning explains how partial loss of NDUFA13 can create an electron leak resulting in H₂O₂ generation without affecting membrane potential

What expression systems are optimal for producing recombinant Macaca fascicularis NDUFA13?

Several expression systems have been validated for recombinant Macaca fascicularis NDUFA13 production, each with distinct advantages:

Expression SystemAdvantagesConsiderationsApplications
E. coliHigh yield, cost-effective, rapid productionMay lack post-translational modifications, potential for inclusion bodiesStructural studies, antibody production
Mammalian cells (HEK293)Native-like post-translational modifications, proper foldingHigher cost, longer production timeFunctional studies, protein-protein interaction assays
BaculovirusHigh expression levels, eukaryotic processingModerate complexity, intermediate costLarge-scale production, functional studies
YeastCost-effective eukaryotic systemMay have different glycosylation patternsAlternative to mammalian expression
In vitro cell-free systemRapid production, avoids toxicity issuesLower yields, higher costQuick screening, toxic protein expression

For optimal results, consider the following approach:

  • Define your experimental requirements (protein purity, functional activity, yield)

  • For structural studies requiring high yields without emphasis on post-translational modifications, E. coli systems are recommended

  • For functional studies where proper folding and post-translational modifications are critical, mammalian HEK293 cells provide the most physiologically relevant environment

  • Include appropriate tags (His, Avi, Fc, GST) based on downstream applications and purification strategies

The choice of expression system should align with the specific research question being addressed.

What methods are most effective for validating the functionality of recombinant NDUFA13?

Validating the functionality of recombinant NDUFA13 requires a multi-faceted approach:

  • Biochemical activity assessment:

    • Measure NADH dehydrogenase activity using spectrophotometric assays that monitor NADH oxidation

    • Assess electron transfer capabilities through high-resolution respirometry using Oxygraph-2k to determine complex I, II, and IV respiration rates

    • Evaluate ATP binding capacity through binding assays

  • Structural integrity verification:

    • Circular dichroism to confirm proper secondary structure formation

    • Limited proteolysis to assess folding quality

    • Size exclusion chromatography to verify monomeric state and absence of aggregation

  • Functional complementation assays:

    • Restore function in NDUFA13-depleted systems:

      • Transfect NDUFA13-knockout cells with recombinant protein and measure restoration of complex I activity

      • Use adenoviral expression systems containing Myh6-Cre to deplete endogenous NDUFA13 in neonatal mouse cardiomyocytes (NMCMs), then rescue with recombinant protein

  • Protein-protein interaction assessment:

    • Co-immunoprecipitation with known binding partners (STAT3, NOD2, NDUFA2, etc.)

    • Surface plasmon resonance (SPR) to quantify binding kinetics with interaction partners

    • Proximity ligation assays to verify interactions in cellular contexts

  • Cell-based functional assays:

    • Measure effects on H₂O₂ production using Amplex red assays in isolated mitochondria

    • Assess impact on superoxide generation using mitoSOX red

    • Evaluate site-specific H₂O₂ generation using cyto-HyPer and mito-HyPer systems

    • Monitor STAT3 dimerization and activation of antiapoptotic signaling

The most conclusive validation combines multiple approaches, particularly matching biochemical activity with cellular functional outcomes.

How can researchers effectively design knockdown/knockout studies to investigate NDUFA13 function?

Designing effective knockdown/knockout studies for NDUFA13 requires careful consideration of several factors:

  • Model selection based on research question:

    • For cardiac function studies: Cardiac-specific tamoxifen-inducible NDUFA13 knockout mice have proven effective

    • For cellular studies: NMCMs from NDUFA13ᶠˡᵒˣ/ᶠˡᵒˣ mice transfected with adenovirus containing Myh6-Cre provide a controlled system

    • For partial knockdown: Heterozygous knockout (cHet) mice exhibit normal cardiac morphology and function in the basal state but show differential responses to stress

  • Targeting strategy:

    • Complete knockout often leads to embryonic lethality, making conditional systems necessary

    • Partial knockdown (heterozygous) models allow study of dose-dependent effects

    • Inducible systems permit temporal control of knockdown to avoid developmental effects

  • Validation approaches:

    • Western blot analysis to confirm protein reduction

    • qPCR to verify mRNA depletion

    • Immunofluorescence to visualize cellular distribution changes

  • Functional assessment methods:

    • Oxygen consumption rate measurement using high-resolution respirometry

    • ROS detection using specific probes (Amplex red, mitoSOX, HyPer systems)

    • Mitochondrial membrane potential assessment

    • Cell death quantification through TUNEL assays and cleaved caspase-3 measurement

  • Rescue experiments:

    • Reintroduce wild-type or mutant NDUFA13 to confirm specificity

    • Structure-function analysis using truncated NDUFA13 cDNAs to identify critical domains

A well-designed example from the literature demonstrates the effectiveness of cardiac-specific heterozygous knockout mice which revealed that moderate down-regulation of NDUFA13 creates a leak within complex I, resulting in a mild increase in cytoplasmic H₂O₂ that activates protective signaling pathways during ischemia-reperfusion injury .

How does NDUFA13 modulation affect ROS generation and what are the implications for cardioprotection?

NDUFA13 modulation creates a specific ROS generation profile with significant implications for cardioprotection:

  • ROS profile with NDUFA13 down-regulation:

    • Moderate down-regulation of NDUFA13 causes a leak within Complex I that specifically increases hydrogen peroxide (H₂O₂) production without affecting superoxide levels at baseline

    • This H₂O₂ increase is localized primarily to the cytosol rather than the mitochondrial matrix

    • The ROS generation occurs without disruption of the mitochondrial membrane potential (MMP)

  • Mechanism of electron leak:

    • NDUFA13's unique position near FeS clusters with lower electrochemical potentials creates a "spillhole" when partially absent

    • This position allows electrons to react with oxygen to form H₂O₂ rather than superoxide

    • The reduction potential of coenzyme Q (+0.113V) is insufficient for producing superoxide (O₂/- O₂⁻ -0.13V) but adequate for H₂O₂ production (O₂/H₂O₂ +0.70V)

  • Cardioprotective signaling pathway:

    • The mild increase in cytosolic H₂O₂ acts as a second messenger

    • This activates peroxiredoxin 2 (PRX2) expression

    • PRX2 facilitates STAT3 dimerization and activation

    • Activated STAT3 enhances Bcl-2 expression

    • Increased Bcl-2 provides antiapoptotic protection

  • Functional outcomes in ischemia-reperfusion (I/R) injury:

    • Cardiac-specific heterozygous NDUFA13 knockout mice show:

      • Significantly decreased infarct size after I/R injury

      • Reduced TUNEL-positive cardiomyocytes in the peri-infarct area

      • Decreased cleaved caspase-3 expression

      • Reduced cytochrome C release into the cytosol

      • Suppression of superoxide burst during reperfusion

This represents a novel mechanism of cardioprotection where mild, localized ROS increase primes protective signaling pathways to prevent the damaging ROS burst during stress. The findings suggest that targeted NDUFA13 modulation could be a therapeutic strategy for conditions involving oxidative stress and ischemic injury.

What is the relationship between NDUFA13 and STAT3 signaling in immune and inflammatory responses?

The relationship between NDUFA13 and STAT3 signaling represents a critical intersection between mitochondrial function and immune regulation:

  • Direct inhibitory interaction:

    • NDUFA13 directly binds to STAT3 transcription factor

    • This binding prevents the transactivation of STAT3 target genes

    • NDUFA13 effectively acts as a negative regulator of STAT3-mediated transcription

  • Impact on immune signaling pathways:

    • NDUFA13 down-regulation leads to enhanced STAT3 signaling

    • This relationship explains the augmented survival in certain tumor cells with reduced NDUFA13 expression

    • In cardiac tissue, moderate NDUFA13 down-regulation promotes STAT3 dimerization through a redox-dependent mechanism involving H₂O₂ and peroxiredoxin 2

  • Role in inflammatory responses:

    • NDUFA13 may play a role in CARD15-mediated innate mucosal responses

    • It helps regulate intestinal epithelial cell responses to microbes

    • Interactions with NOD2 (nucleotide-binding oligomerization domain-containing protein 2) implicate NDUFA13 in pathogen recognition pathways

  • Connection to interferon signaling:

    • NDUFA13 is involved in interferon/all-trans-retinoic acid (IFN/RA) induced cell death

    • This apoptotic activity can be inhibited by interaction with viral IRF1 , suggesting a role in antiviral responses

    • The gene was originally identified as "gene associated with retinoic and interferon-induced mortality 19 protein" (GRIM-19)

  • Dual subcellular localization and function:

    • While primarily recognized as a mitochondrial protein, NDUFA13 also functions in non-mitochondrial locations to regulate STAT3

    • This dual localization allows NDUFA13 to serve as a link between metabolic state and immune signaling

Understanding this relationship provides insight into how mitochondrial proteins can directly influence nuclear gene expression and immune responses, offering potential therapeutic targets for inflammatory conditions and cancer.

How can structural analysis of NDUFA13 inform the development of targeted approaches for mitochondrial dysfunction?

Structural analysis of NDUFA13 provides valuable insights for developing targeted approaches to address mitochondrial dysfunction:

  • Critical structural features with functional relevance:

    • The N-terminal hydrophobic domain forms an alpha helix spanning the inner mitochondrial membrane

    • The C-terminal hydrophilic domain interacts with globular subunits of Complex I

    • The highly conserved two-domain structure suggests critical functional importance

    • The TMH segment penetrates both Iα and Iλ structures of Complex I, creating a unique positioning

    • The first 33 amino acids extend along the CoQ binding chamber and run parallel to FeS clusters

  • Structure-guided targeting strategies:

    • Domain-specific modulation: Target the transmembrane domain to affect anchoring without disrupting electron transfer

    • Interface targeting: Design molecules that modify NDUFA13's interaction with ND1 and ND2 subunits

    • Electron leak control: Develop compounds that can mimic the "spillhole" effect of partial NDUFA13 deficiency to produce cardioprotective H₂O₂ levels

    • Conformation-selective compounds: Create molecules that stabilize specific conformations of NDUFA13 to modulate its activity

  • Potential therapeutic applications:

    • Cardioprotection: Compounds mimicking moderate NDUFA13 down-regulation could provide protection against ischemia-reperfusion injury

    • Cancer therapy: Enhancing NDUFA13 function might restore STAT3 inhibition in tumors where this pathway is dysregulated

    • Neurodegenerative diseases: Modulating the electron leak properties could mitigate oxidative damage in conditions like Alzheimer's and Parkinson's diseases

    • Metabolic disorders: Targeted approaches affecting Complex I efficiency could influence energy metabolism

  • Structure-based screening approaches:

    • Virtual screening against the NDUFA13-ND1/ND2 interface

    • Fragment-based drug discovery focusing on the transmembrane helix

    • Peptide mimetics based on critical interaction domains

    • Allosteric modulators that affect NDUFA13 conformation

What challenges exist in studying NDUFA13 interactions with the respiratory chain and how can they be addressed?

Studying NDUFA13 interactions with the respiratory chain presents several methodological challenges that require specific approaches:

  • Maintaining native membrane environment:

    • Challenge: NDUFA13 is a transmembrane protein embedded in the complex lipid environment of the inner mitochondrial membrane.

    • Solution: Use nanodisc technology to reconstitute NDUFA13 and interacting partners in lipid bilayers that mimic the native environment. Alternatively, employ native electrophoresis methods like Blue Native PAGE to preserve complex integrity .

  • Complex I size and complexity:

    • Challenge: Complex I contains ~45 subunits in mammals, making it difficult to study specific subunit interactions.

    • Solution: Utilize proximity labeling methods such as BioID or APEX2 to identify proteins in close proximity to NDUFA13 within the intact complex. Cryo-electron microscopy has also proven valuable for resolving subunit arrangements .

  • Functional redundancy and compensation:

    • Challenge: Complete knockout of NDUFA13 may trigger compensatory mechanisms that mask true functions.

    • Solution: Employ inducible and partial knockdown systems as demonstrated in cardiac-specific heterozygous knockout mice . Time-course studies after induction can help distinguish direct effects from compensatory responses.

  • Distinguishing NDUFA13's respiratory vs. non-respiratory functions:

    • Challenge: NDUFA13 has dual roles in Complex I and STAT3 signaling that are difficult to separate.

    • Solution: Design mutants that selectively disrupt specific interactions (e.g., STAT3 binding) while preserving others. Domain-swap experiments between species with differential activity can help identify functional regions .

  • Measuring subtle changes in electron flow:

    • Challenge: The "spillhole" electron leak may produce subtle changes difficult to detect with standard methods.

    • Solution: High-resolution respirometry using Oxygraph-2k can detect fine changes in oxygen consumption . Site-specific ROS detection using targeted probes like cyto-HyPer and mito-HyPer provides compartment-specific information .

  • Protein stability and solubility:

    • Challenge: Membrane proteins often aggregate when removed from their native environment.

    • Solution: Use mild detergents like digitonin or lauryl maltose neopentyl glycol (LMNG) for extraction. For recombinant expression, consider fusion partners that enhance solubility while maintaining function.

Addressing these challenges requires combining biochemical, structural, and cell biological approaches to build a comprehensive understanding of NDUFA13's complex interactions within the respiratory chain.

How can researchers distinguish between the respiratory and non-respiratory functions of NDUFA13?

Distinguishing between the respiratory and non-respiratory functions of NDUFA13 requires specialized experimental approaches:

  • Domain-specific mutational analysis:

    • Create targeted mutations that specifically disrupt either respiratory or non-respiratory functions

    • N-terminal hydrophobic domain mutations may primarily affect Complex I integration

    • C-terminal modifications may preferentially impact STAT3 binding

    • Validate mutants by assessing their:

      • Localization to mitochondria

      • Integration into Complex I

      • Ability to bind STAT3

      • Effect on electron transfer

  • Subcellular localization studies:

    • Use fractionation techniques to separate mitochondrial and cytosolic pools of NDUFA13

    • Employ immunofluorescence with high-resolution microscopy to visualize distribution patterns

    • Create fusion proteins with compartment-specific targeting sequences to force localization to specific cellular regions

    • Compare functions of differentially localized NDUFA13 variants

  • Temporal separation of functions:

    • Acute vs. chronic manipulation of NDUFA13 levels may reveal primary vs. secondary effects

    • Immediate responses are more likely related to direct functions

    • Time-course studies tracking both respiratory and STAT3-related outcomes can separate kinetically distinct processes

  • Pathway-specific inhibitors:

    • Use specific inhibitors of Complex I (e.g., rotenone) to block respiratory functions

    • Apply STAT3 pathway inhibitors to block non-respiratory signaling

    • Assess how these interventions affect NDUFA13-dependent phenotypes

  • Complementation approaches:

    • In NDUFA13-deficient systems, introduce:

      • Mitochondria-only targeted NDUFA13

      • Cytosol-only targeted NDUFA13

      • Full-length NDUFA13

    • Compare rescue effects on:

      • Complex I assembly and activity

      • ROS generation profiles

      • STAT3 signaling

      • Cell survival during stress

  • Interactome analysis under different conditions:

    • Compare NDUFA13 interaction partners under:

      • Basal conditions

      • Oxidative stress

      • Cytokine stimulation

    • Use proximity labeling methods (BioID, APEX) combined with mass spectrometry to identify context-specific interactors

These approaches collectively provide a framework for dissecting the multifunctional nature of NDUFA13 and understanding how its diverse roles are coordinated in different cellular contexts.

What are the critical considerations for translating findings from Macaca fascicularis NDUFA13 to human applications?

Translating findings from Macaca fascicularis NDUFA13 to human applications requires careful consideration of several factors:

  • Sequence and structural homology assessment:

    • While Macaca fascicularis NDUFA13 (163 aa) is longer than human NDUFA13 (144 aa), they share high sequence homology

    • Conduct detailed sequence alignment to identify:

      • Conserved functional domains

      • Species-specific variations in key regions

      • Potential differences in post-translational modification sites

    • Structural modeling should confirm similar folding patterns and interaction interfaces

  • Functional conservation verification:

    • Compare biochemical properties:

      PropertyMacaca fascicularisHumanImplications
      Complex I integrationPresentPresentConserved basic function
      STAT3 bindingPresentPresentConserved signaling role
      Apoptosis regulationPresentPresentConserved cell death control
      ROS modulationH₂O₂ generation when downregulatedSimilar pattern expectedPotential conserved mechanism
    • Validate key findings in both species using parallel experimental systems

  • Differential expression and regulation:

    • Compare tissue-specific expression patterns between species

    • Assess regulatory mechanisms controlling NDUFA13 expression:

      • Promoter structure conservation

      • Response to physiological stimuli (e.g., metformin has been shown to prevent high glucose-mediated downregulation of NDUFA13)

      • MicroRNA targeting differences

  • Pharmacological response differences:

    • Test compounds that modulate NDUFA13 in both species' cell models

    • Consider species-specific metabolic differences that might affect drug efficacy

    • Validate biomarkers of NDUFA13 modulation across species

  • Disease relevance translation:

    • Compare NDUFA13 alterations in comparable disease states:

      • Cardiovascular conditions

      • Neurodegenerative diseases

      • Cancer

    • Assess whether disease-associated mutations affect similar pathways

  • Experimental system considerations:

    • When possible, conduct parallel experiments in:

      • Recombinant protein systems from both species

      • Cell lines derived from both species

      • Tissue samples when available

    • Consider using humanized models to bridge the translation gap

  • Ethical and practical considerations:

    • Macaca fascicularis provides a valuable non-human primate model with greater translational relevance than rodent models

    • Balance the ethical use of primate models with the scientific need for translational validation

    • Consider emerging alternatives like organoids or advanced in vitro systems that recapitulate human physiology

By systematically addressing these considerations, researchers can maximize the translational value of findings from Macaca fascicularis NDUFA13 studies while acknowledging and accounting for species-specific differences.

How might NDUFA13 be involved in metabolic diseases and what are promising research approaches?

NDUFA13's involvement in metabolic diseases presents several promising research directions:

  • Connection to non-alcoholic fatty liver disease (NAFLD):

    • NDUFA13 is implicated in the NAFLD pathway according to pathway analysis

    • Research approaches:

      • Investigate NDUFA13 expression in liver biopsies from NAFLD patients

      • Develop hepatocyte-specific NDUFA13 knockout models to assess metabolic consequences

      • Examine how lipid accumulation affects NDUFA13 function and vice versa

      • Explore the relationship between NDUFA13-mediated ROS production and hepatic insulin resistance

  • Role in diabetes and high glucose conditions:

    • High glucose culture downregulates NDUFA13 expression in cardiomyocytes

    • Metformin prevents this downregulation, suggesting a potential mechanism for its beneficial effects

    • Research approaches:

      • Investigate tissue-specific NDUFA13 expression changes in diabetic models

      • Examine how NDUFA13 downregulation affects mitochondrial function in pancreatic β-cells

      • Explore the relationship between NDUFA13, ROS generation, and insulin signaling

      • Test whether targeted NDUFA13 modulation could improve metabolic parameters in diabetic models

  • Interaction with metabolic signaling pathways:

    • NDUFA13 is associated with PKLR (pyruvate kinase, liver and RBC) in metabolic pathway analysis

    • It also relates to ADIPOR1 (adiponectin receptor 1)

    • Research approaches:

      • Investigate how NDUFA13 modulates or responds to key metabolic regulators like AMPK

      • Examine cross-talk between mitochondrial function and adipokine signaling

      • Assess how nutrient availability affects NDUFA13 expression and function

      • Study post-translational modifications of NDUFA13 in response to metabolic states

  • Therapeutic targeting approaches:

    • Develop compounds that stabilize NDUFA13 in conditions where it's downregulated

    • Explore whether the cardioprotective effects of moderate NDUFA13 downregulation extend to metabolic tissue protection

    • Investigate combination approaches targeting NDUFA13 alongside established metabolic regulators

  • Novel methodological approaches:

    • Metabolic flux analysis to determine how NDUFA13 modulation affects substrate utilization

    • In vivo imaging of tissue-specific ROS generation in NDUFA13 mutant models

    • Single-cell transcriptomics to identify cell populations most affected by NDUFA13 dysfunction

    • Integration of multi-omics data to place NDUFA13 in the broader context of metabolic regulation

The relationship between mitochondrial function and metabolic disease makes NDUFA13 a particularly interesting target, especially considering its dual role in respiratory chain function and signaling pathway regulation.

What role might NDUFA13 play in neurodegenerative diseases and what experimental models would be most informative?

NDUFA13's potential role in neurodegenerative diseases presents an important research frontier:

  • Connection to established neurodegenerative pathways:

    • NDUFA13 is implicated in pathways related to Alzheimer's disease, Parkinson's disease, and Huntington's disease

    • Associated with key neurodegenerative proteins including MAPT (tau), GSK3B, PARK7 (DJ-1), and UCHL1

  • Potential mechanistic contributions:

    • Mitochondrial dysfunction: As a Complex I component, NDUFA13 alterations may contribute to the well-established mitochondrial defects in neurodegenerative diseases

    • Oxidative stress regulation: The specific ROS profile generated by NDUFA13 modulation could influence neuronal survival

    • Apoptotic regulation: NDUFA13's role in cell death pathways is relevant to neurodegeneration

    • STAT3 signaling: NDUFA13 inhibits STAT3, which has neuroprotective functions in some contexts

  • Most informative experimental models:

    • Cellular models:

      • Primary neurons with NDUFA13 knockdown/overexpression

      • Human iPSC-derived neurons from patients with neurodegenerative diseases

      • Microfluidic chambers to study NDUFA13's role in axonal transport and health

      • Organotypic brain slice cultures to maintain neural circuit integrity

    • Animal models:

      • Neuron-specific conditional NDUFA13 knockout mice

      • Models combining NDUFA13 modulation with established neurodegenerative mutations

      • Non-human primate models including Macaca fascicularis for translational studies

      • Drosophila models for high-throughput genetic interaction screening

    • Human studies:

      • Post-mortem brain tissue analysis for NDUFA13 expression/localization changes

      • Genetic association studies examining NDUFA13 variants in patient cohorts

      • Biomarker development based on NDUFA13 pathway activation

  • Key experimental approaches:

    • Functional assessment:

      • High-resolution respirometry in isolated brain mitochondria

      • In vivo imaging of neuronal ROS using genetically encoded sensors

      • Electrophysiological recordings to assess neuronal function

      • Behavioral testing in animal models

    • Molecular analysis:

      • Proteomic analysis of NDUFA13 interactome in neural tissues

      • Examination of post-translational modifications in disease states

      • Subcellular localization studies in affected neurons

      • Single-cell transcriptomics to identify vulnerable neuronal populations

  • Therapeutic exploration:

    • Test whether the cardioprotective effects of moderate NDUFA13 downregulation extend to neuroprotection

    • Develop compounds that can modulate NDUFA13 function in the CNS

    • Explore combination approaches targeting both NDUFA13 and established neurodegenerative pathways

NDUFA13's involvement in multiple cellular processes relevant to neurodegeneration makes it an intriguing target for understanding and potentially treating these devastating diseases.

How can advanced imaging techniques enhance our understanding of NDUFA13 dynamics in living systems?

Advanced imaging techniques offer powerful approaches to understanding NDUFA13 dynamics:

  • Super-resolution microscopy applications:

    • STORM/PALM: Achieve ~20nm resolution to visualize NDUFA13 within Complex I architecture

    • STED microscopy: Examine NDUFA13 distribution relative to other mitochondrial structures

    • SIM (Structured Illumination Microscopy): Track NDUFA13 reorganization during mitochondrial stress

    • Expansion microscopy: Physically expand specimens to resolve NDUFA13 positioning within Complex I

  • Live-cell imaging approaches:

    • NDUFA13-fluorescent protein fusions: Track dynamics in real-time

    • Split fluorescent protein complementation: Visualize NDUFA13 interactions with binding partners

    • FRET sensors: Detect conformational changes or protein-protein interactions

    • Targeted biosensors: Monitor local ROS production near NDUFA13 using genetically-encoded redox sensors

  • Multi-modal imaging combinations:

    • Correlative light and electron microscopy (CLEM): Link NDUFA13 fluorescence with ultrastructural features

    • Functional imaging with electrophysiology: Correlate NDUFA13 dynamics with mitochondrial membrane potential

    • Label-free imaging with fluorescence: Combine techniques like Raman microscopy with fluorescent labeling

  • Advanced tissue imaging applications:

    • Tissue clearing techniques: Visualize NDUFA13 distribution in intact organs

    • Intravital microscopy: Observe NDUFA13 dynamics in living animals

    • Light-sheet microscopy: Image large tissue volumes with minimal phototoxicity

    • Multi-photon microscopy: Achieve deep tissue imaging with reduced photodamage

  • Dynamic tracking methodologies:

    • Single-particle tracking: Follow individual NDUFA13-containing complexes

    • Fluorescence recovery after photobleaching (FRAP): Measure NDUFA13 mobility and exchange rates

    • Photoactivation/photoconversion: Track specific subpopulations of NDUFA13

    • Optogenetic approaches: Manipulate NDUFA13 function with light while imaging responses

  • Quantitative image analysis approaches:

    • Machine learning algorithms: Automatically identify and track NDUFA13-containing structures

    • Computational modeling: Integrate imaging data with structural information

    • Spatial statistics: Analyze NDUFA13 distribution patterns and co-localization

    • 4D analysis: Track changes in NDUFA13 dynamics over time in three dimensions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.