Role in Complex I: MT-ND4L is part of the minimal core subunits required for NADH dehydrogenation and electron transfer to ubiquinone. It contributes to the proton-pumping activity of Complex I, generating an electrochemical gradient for ATP synthesis .
Gene Overlap: The MT-ND4L gene overlaps with MT-ND4, sharing coding regions for their terminal and initial codons, respectively. This overlap highlights evolutionary conservation in mitochondrial genomes .
Species-Specific Variations: In Macaca fascicularis, the recombinant MT-ND4L protein (UniProt ID Q7J3C3) includes a His-tag for purification and exhibits sequence homology to human MT-ND4L, facilitating cross-species studies .
Recombinant MT-ND4L is typically expressed in E. coli or yeast systems, with purification involving affinity chromatography (e.g., Ni-NTA columns for His-tagged proteins).
| Parameter | Value |
|---|---|
| Expression System | E. coli or yeast |
| Tag | N-terminal His-tag |
| Protein Length | Full-length (1–98 amino acids) |
| Purity | >90% (SDS-PAGE validated) |
| Storage Buffer | Tris/PBS-based buffer with 6% trehalose, pH 8.0 |
| Storage Conditions | -20°C/-80°C; avoid repeated freeze-thaw cycles |
Amino Acid Sequence:
MTPTYMNIMLAFTISLLGMLTYRSHLVASLLCLEGMMMSLFIMATLIASNTHFPLVNIMP IILLVFAACETAVGLALLISISNTYGLDYVHNLNLLQC
ELISA Development: Recombinant MT-ND4L is used as an antigen in enzyme-linked immunosorbent assays (ELISA) to detect anti-Complex I antibodies in mitochondrial disorders .
Neurodegeneration Research: Inhibitors of Complex I (e.g., rotenone) are used to model Parkinson’s disease in vitro. MT-ND4L variants help elucidate how Complex I dysfunction triggers dopaminergic neuron loss .
Parkinson’s Disease: Rotenone-induced Complex I inhibition in nigrostriatal neurons correlates with neuroinflammation and dopaminergic neuron degeneration. MT-ND4L studies reveal that restored Complex I activity mitigates oxidative stress and apoptosis .
Obesity and Metabolic Disorders: Polymorphisms in mitochondrial Complex I subunits (including MT-ND4L) associate with increased BMI and insulin resistance, highlighting its role in energy homeostasis .
Primate Models: Recombinant MT-ND4L from Macaca fascicularis aligns with human and other primate orthologs, enabling comparative studies on mitochondrial evolution and disease susceptibility .
Protein Stability: The hydrophobic nature of MT-ND4L complicates solubility and crystallization, necessitating advanced biophysical techniques for structural studies .
Therapeutic Targets: Modulating MT-ND4L expression or function could address Complex I deficiencies, though challenges in delivering mitochondrial-targeted therapies persist .
MT-ND4L (Mitochondrially Encoded NADH:Ubiquinone Oxidoreductase Core Subunit 4L) provides instructions for making the NADH dehydrogenase 4L protein, a critical component of Complex I in the mitochondrial respiratory chain. This protein participates in the first step of the electron transport process, transferring electrons from NADH to ubiquinone . As part of Complex I, MT-ND4L is embedded in the inner mitochondrial membrane and contributes to the creation of an electrochemical gradient that drives ATP production through oxidative phosphorylation . The protein plays a fundamental role in cellular energy metabolism, converting the energy from food into a form that cells can use through the production of adenosine triphosphate (ATP) .
The MT-ND4L gene demonstrates significant conservation across primate species, reflecting its essential role in cellular respiration. In Macaca fascicularis (cynomolgus macaque), the mitochondrial genome contains 16,571 base pairs, with MT-ND4L being one of the protein-coding genes within this genome . Phylogenetic analyses incorporating whole mitochondrial DNA genomes from various primate species have shown that M. fascicularis has the closest genetic affinity with Macaca mulatta (rhesus macaque) . The conservation of MT-ND4L across primate species makes it a valuable target for evolutionary studies and comparative genomics, allowing researchers to track mitochondrial evolution and divergence patterns among primates .
For studying recombinant Macaca fascicularis MT-ND4L, several expression systems have proven effective, each with distinct advantages depending on research objectives. Common expression systems include:
The choice of system depends on research requirements, with E. coli systems being suitable for basic structural studies, while mammalian cell systems provide more physiologically relevant contexts for functional analyses . For comprehensive characterization, using multiple expression systems in parallel can provide complementary insights into MT-ND4L structure and function.
Mutations in the human MT-ND4L gene have been linked to Leber hereditary optic neuropathy (LHON), characterized by vision loss due to optic nerve degeneration . The T10663C mutation (Val65Ala) in human MT-ND4L changes a single amino acid in the protein, potentially affecting Complex I function . Recombinant Macaca fascicularis MT-ND4L can serve as a model system for studying these mutations due to the high conservation between human and macaque mitochondrial genes.
By introducing equivalent mutations into recombinant M. fascicularis MT-ND4L and studying their effects on protein function, researchers can gain insights into pathogenic mechanisms without the ethical concerns associated with human experimentation. This approach allows for detailed analysis of how specific amino acid changes alter protein structure, Complex I assembly, electron transport efficiency, reactive oxygen species production, and ultimately, cellular energy metabolism in a highly relevant primate model.
Isolating functional recombinant MT-ND4L presents several technical challenges:
Hydrophobicity: MT-ND4L is highly hydrophobic and membrane-bound, making solubilization difficult without compromising function.
Complex I integration: The protein naturally functions as part of the larger Complex I, and isolation may disrupt essential protein-protein interactions.
Mitochondrial DNA origin: As a mitochondrially-encoded protein, MT-ND4L uses a slightly different genetic code than nuclear-encoded proteins, requiring codon optimization for recombinant expression.
Post-translational modifications: Ensuring proper membrane targeting and assembly requires appropriate post-translational processing.
To overcome these challenges, researchers often employ specialized approaches:
Detergent screening to identify optimal solubilization conditions that preserve protein function
Co-expression with other Complex I components to maintain structural integrity
Use of specialized tags (His, FLAG, etc.) that facilitate purification while minimizing functional interference
Development of functional assays that can detect activity in isolation or partial complexes
Phylogenetic analyses reveal that M. fascicularis initially diverged into two major mitochondrial clades approximately 1.70 million years ago, with subsequent diversification of local populations around 0.93-0.84 Ma . This evolutionary history has implications for experimental design when working with recombinant MT-ND4L:
Sequence Variation: Different geographical populations of M. fascicularis may exhibit variations in MT-ND4L sequences, necessitating careful source selection and sequence verification.
Functional Conservation: Despite sequence variations, functional domains are typically conserved, but subtle differences may affect interactions with other Complex I components.
Cross-Species Compatibility: When designing experiments to compare with human data, differences in MT-ND4L sequences must be accounted for, particularly in protein interaction studies or when developing therapeutic approaches.
Reference Sequence Selection: Researchers must carefully select appropriate reference sequences based on the geographical origin of their M. fascicularis samples, as local populations form distinct phylogenetic clades .
These evolutionary considerations directly impact experimental design decisions, including the choice of control sequences, interpretation of cross-species data, and applicability of findings to human mitochondrial biology.
The choice of expression system significantly impacts the functional activity of recombinant MT-ND4L. Based on available data, the following comparative analysis guides system selection:
Purifying recombinant MT-ND4L while maintaining its stability and activity requires specialized approaches due to its hydrophobic nature and integration within Complex I. A multi-step purification strategy typically yields the best results:
Gentle Solubilization: Digitonin or n-dodecyl β-D-maltoside (DDM) at optimized concentrations effectively solubilize mitochondrial membranes while preserving protein-protein interactions.
Affinity Chromatography: His-tagged or biotinylated MT-ND4L can be purified using nickel or streptavidin affinity columns, respectively. Elution conditions must be carefully optimized to prevent protein denaturation.
Size Exclusion Chromatography: This helps separate functional complexes from aggregates and provides information about the oligomeric state of the purified protein.
Lipid Reconstitution: For functional studies, reconstitution into liposomes or nanodiscs containing cardiolipin and other mitochondrial lipids helps maintain native-like environment.
Throughout purification, maintaining physiological pH (typically 7.2-7.4) and including stabilizing agents such as glycerol (10-15%) and reducing agents helps preserve protein integrity. Temperature control is also critical, with all steps preferably performed at 4°C to minimize degradation.
Recent advances in genome editing technologies offer powerful approaches for studying MT-ND4L function in cellular contexts. Particularly promising is the development of double-stranded-DNA deaminase-derived cytosine base editors (DdCBEs) optimized for mitochondrial DNA manipulation . These tools enable precise ablation of mitochondrial protein-coding genes, including MT-ND4L, without disrupting the entire mitochondrial genome.
The application of these technologies follows this general methodology:
Design of guide RNAs specific to MT-ND4L sequences in Macaca fascicularis mitochondrial DNA.
Optimization of the DdCBE construct for mitochondrial targeting and efficient editing (MitoKO DdCBE construct) .
Delivery of the editing system to target cells via transfection or viral transduction.
Verification of editing efficiency using sequencing and assessment of MT-ND4L protein levels.
Functional characterization of edited cells through assays measuring:
Complex I activity
Mitochondrial membrane potential
ATP production
Reactive oxygen species generation
Cell viability under various metabolic conditions
This approach allows for precise manipulation of MT-ND4L in a physiologically relevant context, enabling researchers to study gene function without the limitations of in vitro reconstitution systems.
Interpreting MT-ND4L functional data requires careful consideration of its role within the larger Complex I structure and function. When analyzing experimental results:
Robust control experiments are critical for ensuring the validity of research involving recombinant MT-ND4L:
Expression Validation Controls:
Western blot comparison with native MT-ND4L from Macaca fascicularis mitochondria
Mass spectrometry verification of protein sequence and post-translational modifications
Subcellular localization confirmation using fractionation and immunofluorescence
Functional Controls:
Comparison with inactive MT-ND4L mutants (e.g., site-directed mutations in conserved residues)
Side-by-side testing with other species' MT-ND4L to assess evolutionary conservation of function
Activity measurements in the presence of specific Complex I inhibitors (e.g., rotenone, piericidin A)
Experimental System Controls:
Empty vector or irrelevant protein expression using identical systems
Wild-type cells with normal MT-ND4L expression
Cells depleted of MT-ND4L through RNA interference or genome editing
Reconstitution Controls:
Verification of proper membrane integration using protease protection assays
Assessment of protein stability under experimental conditions
Demonstration of interaction with known Complex I partners
Implementing these control experiments provides a framework for distinguishing specific MT-ND4L effects from artifacts related to the expression system, purification method, or experimental conditions.
Phylogenetic analyses of mitochondrial genomes provide valuable context for interpreting functional differences in MT-ND4L across primate species. The mitochondrial genome of Macaca fascicularis has been comprehensively sequenced and analyzed in relation to other primates , revealing:
Evolutionary Relationships: M. fascicularis shows closest genetic affinity with Macaca mulatta based on whole mitochondrial genome analysis . This relationship should be considered when comparing functional data between these species.
Population Divergence: Within M. fascicularis, populations diverged into two major clades approximately 1.70 million years ago, with one clade (A) including mainland Southeast Asia, Malay Peninsula, and North Sumatra populations, and another clade (B) containing populations from Bangka, Java, Borneo, Timor, and the Philippines . These divergence patterns may correlate with subtle functional differences in MT-ND4L.
Functional Conservation: Regions of MT-ND4L showing high conservation across evolutionary time likely represent functionally critical domains. Conversely, regions with higher variability may indicate adaptive evolution or functionally less constrained areas.
Selection Pressure: Analysis of non-synonymous to synonymous substitution ratios can identify regions under positive or purifying selection, providing insights into the evolutionary forces shaping MT-ND4L function.
When interpreting experimental data, researchers should consider the specific M. fascicularis population source and its phylogenetic relationship to other experimental models, particularly when translating findings to human applications or other primate models.
Several cutting-edge technologies are poised to transform research on Macaca fascicularis MT-ND4L:
Mitochondrial Base Editing: The development of DdCBE technology optimized for mitochondrial DNA editing enables precise manipulation of MT-ND4L in living cells . This approach allows researchers to introduce specific mutations or create knockouts without disrupting the entire mitochondrial genome, facilitating detailed functional studies in cellular and potentially organismal contexts.
Cryo-Electron Microscopy: Advances in cryo-EM now enable visualization of membrane proteins at near-atomic resolution. Application to recombinant MT-ND4L could reveal detailed structural information, particularly regarding its integration within Complex I and conformational changes during electron transport.
In Situ Structural Analysis: Techniques such as super-resolution microscopy and proximity labeling (BioID, APEX) can provide insights into MT-ND4L's interactions and organization within intact mitochondria, bridging the gap between biochemical studies and cellular physiology.
Single-Cell Omics: Integration of single-cell transcriptomics, proteomics, and metabolomics allows for unprecedented analysis of cell-to-cell variation in MT-ND4L expression and function, particularly valuable for understanding heterogeneity in disease models.
Organoid Models: Development of mitochondria-rich organoid systems derived from Macaca fascicularis tissues could provide physiologically relevant 3D models for studying MT-ND4L function in tissue-specific contexts.
These technologies, particularly when combined in complementary approaches, promise to address longstanding questions about MT-ND4L's role in mitochondrial function and disease mechanisms.
Developing targeted drug delivery systems for compounds affecting MT-ND4L function presents unique challenges due to the protein's location within the inner mitochondrial membrane. Promising strategies include:
Mitochondrial Targeting Sequences: Conjugating therapeutic compounds with mitochondrial targeting sequences (MTS) derived from naturally mitochondria-targeted proteins can enhance delivery specificity. These peptide sequences are recognized by the mitochondrial import machinery, facilitating transport across the outer mitochondrial membrane.
Lipophilic Cation-Based Carriers: Compounds like triphenylphosphonium (TPP) can serve as carriers for therapeutic molecules. The positive charge of these carriers promotes accumulation in mitochondria due to the negative mitochondrial membrane potential.
Mitochondria-Targeted Nanoparticles: Engineered nanoparticles with surface modifications that promote mitochondrial localization can deliver larger therapeutic payloads, including proteins or nucleic acids targeting MT-ND4L expression or function.
Mitochondria-Penetrating Peptides: Specialized peptides designed to cross both the outer and inner mitochondrial membranes can deliver therapeutic compounds directly to the vicinity of MT-ND4L.
Research on Macaca fascicularis MT-ND4L has significant implications for understanding human mitochondrial disorders, particularly those involving Complex I dysfunction:
Translational Insights: Due to the high conservation of mitochondrial proteins between macaques and humans, findings from M. fascicularis MT-ND4L studies can often be directly applied to understanding human pathophysiology. Specific mutations identified in the human MT-ND4L gene, such as the T10663C (Val65Ala) mutation associated with Leber hereditary optic neuropathy , can be studied in the macaque system to elucidate disease mechanisms.
Therapeutic Development: Macaque models provide an essential bridge between cellular systems and human applications for testing potential therapeutics targeting MT-ND4L or compensating for its dysfunction. The evolutionary proximity makes macaques particularly valuable for assessing both efficacy and safety of mitochondrial interventions.
Biomarker Discovery: Comparative studies between normal and dysfunctional MT-ND4L in macaque models may reveal biomarkers applicable to human mitochondrial disorders, facilitating earlier diagnosis and treatment monitoring.
Aging Research: MT-ND4L dysfunction contributes to age-related mitochondrial decline. Research in macaque models, which have longer lifespans than rodents, provides more relevant insights into human aging processes and potential interventions.
Evolutionary Medicine: Understanding the evolutionary changes in MT-ND4L across primates helps identify regions under selection pressure, potentially revealing adaptive mechanisms that could inspire novel therapeutic approaches for human mitochondrial disorders.
By leveraging the close evolutionary relationship between Macaca fascicularis and humans, researchers can develop more effective translational strategies for addressing human mitochondrial diseases, particularly those involving Complex I dysfunction.