Recombinant Macaca fascicularis Omega-3 fatty acid receptor 1 (O3FAR1)

Shipped with Ice Packs
In Stock

Description

Functional Properties and Biological Significance

The Omega-3 fatty acid receptor 1 from Macaca fascicularis serves as a key cellular receptor that recognizes and responds to medium and long-chain free fatty acids, particularly omega-3 fatty acids such as docosahexaenoic acid (DHA) . Studies indicate that this receptor plays a vital role in numerous physiological processes including inflammation regulation, lipid metabolism, and neural development .

Role in Brain Development and Function

Research utilizing functional connectivity MRI has revealed that omega-3 fatty acid receptors play crucial roles in the development and maintenance of distributed, large-scale brain systems . Specifically, studies with macaques have demonstrated that animals with adequate dietary omega-3 fatty acids, which interact with receptors like O3FAR1, display cortical modular organization resembling the healthy human brain . In contrast, primates with deficient omega-3 fatty acid intake show decreased functional connectivity within the early visual pathway and throughout higher-order associational cortex, suggesting impairment of distributed cortical networks .

This evidence underscores the importance of omega-3 fatty acid signaling through receptors like O3FAR1 in maintaining proper brain organization and function. The receptor appears to be particularly important for visual system development, as deficiencies in omega-3 fatty acid signaling have been linked to delayed visual acuity development and altered rod photoreceptor function in non-human primates .

Anti-inflammatory and Metabolic Functions

While specific data on the Macaca fascicularis form is limited in the search results, related omega-3 fatty acid receptors demonstrate significant anti-inflammatory effects, particularly in macrophages and adipose tissue . The anti-inflammatory mechanism involves inhibition of TAK1 through a beta-arrestin 2-dependent pathway . This function positions O3FAR1 as a potentially important target in inflammatory and metabolic disorders.

Research Applications and Experimental Uses

The recombinant form of Macaca fascicularis O3FAR1 serves multiple important research purposes, primarily as a tool for investigating omega-3 fatty acid signaling pathways and their physiological implications.

ELISA-Based Detection Systems

The recombinant protein is utilized in Enzyme-Linked Immunosorbent Assay (ELISA) systems designed to detect and quantify O3FAR1 levels in biological samples . These assays enable researchers to study expression patterns and regulation of the receptor under various physiological and pathological conditions. Commercial ELISA kits incorporating the recombinant protein typically offer detection ranges from 0.625-40 ng/ml with sensitivities approaching 0.322 ng/mL .

Neurodevelopmental Research

Given the established role of omega-3 fatty acid signaling in brain development, the recombinant O3FAR1 serves as an important tool in neurodevelopmental research . Studies utilizing this protein have contributed to understanding how omega-3 fatty acids influence large-scale brain organization and function. This research has significant implications for neurodevelopmental disorders where impaired fatty acid metabolism or signaling may play a role .

Comparative Studies with Human Systems

The high degree of similarity between macaque and human brain organization makes the Macaca fascicularis O3FAR1 particularly valuable for translational research . Studies have demonstrated that monkeys with healthy omega-3 fatty acid levels (and presumably normal receptor function) display brain organization patterns remarkably similar to healthy humans . This makes the recombinant macaque receptor a useful model for understanding human omega-3 fatty acid signaling and its implications for health and disease.

Reconstitution Protocols

For lyophilized forms of the recombinant protein, specific reconstitution protocols are recommended. These typically involve centrifuging the vial briefly before opening to bring contents to the bottom, followed by reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Adding glycerol to a final concentration of 5-50% (typically 50% is standard) is recommended for samples intended for long-term storage at -20°C or -80°C .

Current Research Landscapes and Future Directions

Research involving the recombinant Macaca fascicularis O3FAR1 continues to evolve, with several promising avenues for future investigation.

Therapeutic Target Potential

Given the receptor's role in mediating the effects of omega-3 fatty acids, particularly their anti-inflammatory properties, O3FAR1 represents a potential therapeutic target for conditions involving inflammation, metabolic dysfunction, or neurological development . Understanding the structure and function of this receptor could facilitate the development of targeted interventions for these conditions.

Comparative Studies Across Species

While the search results primarily focus on the Macaca fascicularis form, comparative studies with omega-3 fatty acid receptors from other species, such as rats (as mentioned in search result ), could provide valuable insights into evolutionary conservation and functional significance of these receptors. Such comparative approaches might reveal species-specific adaptations in omega-3 fatty acid signaling pathways.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to concentrate the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
FFAR4; GPR120; O3FAR1; Free fatty acid receptor 4; G-protein coupled receptor 120; Omega-3 fatty acid receptor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-361
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
Target Protein Sequence
MSPECARAAGDAPLRSLEQANRTRFSFFSDVKGDHRLLLAAVETTVLALIFAVSLLGNVC ALVLVARRRRRGTTACLVLNLFCADLLFISAIPLVLAVRWTEAWLLGPVACHLLFYLMTL SGSVTILTLAAVSLERMVCIVHLQRGVRGPGRRARAVLLTLIWGYSAVAALPLCVFFRVV PQRLPGADQEISICTLIWPTIAGEISWDVSFVTLNFLVPGLVIVISYSKILQITKASRKR LTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIMWSPIIITILLILIQNFKQDLVIWP SLFFWVVAFTFANSALNPILYNMTLCRNEWKKIFCCFWFPEKGAILTDTSVKRNDLSVIS G
Uniprot No.

Target Background

Function
Omega-3 fatty acid receptor 1 (O3FAR1) is a G-protein-coupled receptor for long-chain fatty acids (LCFAs) that plays a crucial role in adipogenesis, energy metabolism, and inflammation. It signals through G-protein and beta-arrestin pathways. LCFAs sensing triggers activation of phosphoinositidase C-linked G proteins GNAQ and GNA11 (G(q)/G(11)), initiating a variety of cellular responses via second messenger pathways such as intracellular calcium mobilization, modulation of cyclic adenosine monophosphate (cAMP) production, and mitogen-activated protein kinases (MAPKs). Following LCFAs binding, O3FAR1 associates with beta-arrestin ARRB2, acting as an adapter protein connecting the receptor to specific downstream signaling pathways and mediating receptor endocytosis. In response to dietary fats, O3FAR1 plays a significant role in regulating adipocyte proliferation and differentiation. It acts as a receptor for omega-3 polyunsaturated fatty acids (PUFAs) at the primary cilium of perivascular preadipocytes, initiating an adipogenic program via cAMP and CTCF-dependent chromatin remodeling that ultimately leads to transcriptional activation of adipogenic genes and cell cycle entry. O3FAR1 induces differentiation of brown and beige adipocytes likely through autocrine and endocrine functions of FGF21 hormone. It contributes to the thermogenic activation of brown adipose tissue and the browning of white adipose tissue. O3FAR1 activates brown adipocytes by initiating intracellular calcium signaling, leading to mitochondrial depolarization and fission, ultimately increasing mitochondrial respiration. Consequently, it stimulates fatty acid uptake and oxidation in mitochondria along with UCP1-mediated thermogenic respiration, eventually reducing fat mass. O3FAR1 regulates bi-potential differentiation of bone marrow mesenchymal stem cells toward osteoblasts or adipocytes likely by up-regulating distinct integrins. In response to dietary fats, O3FAR1 regulates hormone secretion and appetite. It stimulates GIP and GLP1 secretion from enteroendocrine cells as well as GCG secretion in pancreatic alpha cells, thereby playing a role in regulating blood glucose levels. O3FAR1 negatively regulates glucose-induced SST secretion in pancreatic delta cells. It mediates LCFAs inhibition of GHRL secretion, an appetite-controlling hormone. In taste buds, O3FAR1 contributes to sensing of dietary fatty acids by the gustatory system. During the inflammatory response, O3FAR1 promotes anti-inflammatory M2 macrophage differentiation in adipose tissue. It mediates the anti-inflammatory effects of omega-3 PUFAs via inhibition of NLRP3 inflammasome activation. In this pathway, O3FAR1 interacts with adapter protein ARRB2 and inhibits the priming step triggered by Toll-like receptors (TLRs) at the level of TAK1 and TAB1. Furthermore, it inhibits the activation step when ARRB2 directly associates with NLRP3, leading to inhibition of proinflammatory cytokine release. O3FAR1 mediates LCFAs anti-apoptotic effects.
Database Links

KEGG: mcf:102136156

UniGene: Mfa.16163

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Cell projection, cilium membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in lung and colon.

Q&A

What is Omega-3 Fatty Acid Receptor 1 (O3FAR1) and what is its significance in Macaca fascicularis research?

Omega-3 Fatty Acid Receptor 1 (O3FAR1), also known as G-protein coupled receptor 120 (GPR120), functions as a receptor for medium and long-chain free fatty acids in Macaca fascicularis. This receptor signals through a G(q)/G(11)-coupled pathway and plays a crucial role in mediating anti-inflammatory effects, particularly in macrophages and adipocytes . The significance of studying O3FAR1 in Macaca fascicularis lies in its evolutionary proximity to humans, making it an excellent translational model for investigating metabolic disorders, inflammation regulation, and potential therapeutic interventions. O3FAR1 has been implicated in insulin sensitization and possesses antidiabetic effects by suppressing macrophage-induced tissue inflammation .

What are the recommended detection methods for Macaca fascicularis O3FAR1 in tissue samples?

For detecting Macaca fascicularis O3FAR1 in tissue samples, enzyme-linked immunosorbent assay (ELISA) represents a highly sensitive and specific methodology. Commercial ELISA kits employ biotin-conjugated polyclonal antibodies specific for O3FAR1, coupled with avidin conjugated to horseradish peroxidase (HRP) for sensitive detection . For tissue-specific expression analysis, immunohistochemistry using specific anti-O3FAR1 antibodies provides spatial localization information. Western blotting offers protein expression quantification, while RT-PCR and qPCR enable mRNA expression analysis. For advanced applications, RNA in situ hybridization can localize mRNA expression in specific cell types within tissues. Each method has distinct sensitivity thresholds and technical considerations that should be evaluated based on specific research objectives.

How should researchers design knockdown experiments to study O3FAR1 function in Macaca fascicularis models?

For effective knockdown of O3FAR1 in Macaca fascicularis models, researchers should employ a multi-tiered approach. Based on successful methodologies in related research, an adeno-associated virus (AAV) vector expressing short hairpin RNA (shRNA) targeting the Ffar1 gene represents an effective approach for tissue-specific knockdown . When designing such experiments, researchers should:

  • Select multiple shRNA sequences targeting conserved regions of the O3FAR1 gene

  • Validate knockdown efficiency in relevant cell lines derived from Macaca fascicularis before in vivo application

  • Incorporate appropriate control vectors (scrambled shRNA) for comparison

  • Consider cell-type specific promoters for targeted expression

  • Monitor phenotypic changes systematically, including metabolic parameters, inflammatory markers, and physiological responses to dietary interventions

Research has demonstrated that knockdown of Ffar1 in specific neurons (e.g., POMC neurons) can significantly alter feeding behavior and metabolic outcomes, inducing hyperphagia and weight gain in experimental models .

What are the most effective methods for producing and purifying recombinant Macaca fascicularis O3FAR1 protein?

Production and purification of recombinant Macaca fascicularis O3FAR1 presents unique challenges due to its nature as a multi-pass transmembrane protein. The most effective methodology involves:

  • Expression System Selection: Mammalian expression systems (HEK293 or CHO cells) generally yield properly folded, functionally active O3FAR1 with appropriate post-translational modifications.

  • Construct Design:

    • Incorporate affinity tags (His6, FLAG, or Strep-tag II) at the N-terminus

    • Include a cleavable signal peptide to enhance membrane targeting

    • Consider fusion partners to improve solubility and stability

  • Purification Protocol:

    • Membrane preparation using differential centrifugation

    • Solubilization with mild detergents (DDM, LMNG, or GDN)

    • Affinity chromatography followed by size exclusion chromatography

  • Quality Control:

    • Western blotting and mass spectrometry for identity confirmation

    • Ligand binding assays to verify functional integrity

    • Circular dichroism to assess secondary structure

This systematic approach ensures production of high-quality recombinant protein suitable for structural studies, antibody production, and functional characterization.

How can researchers effectively measure O3FAR1 activation in Macaca fascicularis tissue samples?

Measuring O3FAR1 activation in Macaca fascicularis tissue samples requires a comprehensive approach targeting multiple signaling aspects. The most informative methodologies include:

  • Calcium Flux Assays: Measure intracellular calcium mobilization using fluorescent indicators (Fura-2 or Fluo-4) in isolated primary cells or tissue slices. This directly reflects O3FAR1 activation through the G(q)/G(11) pathway.

  • Phosphorylation Analysis: Quantify phosphorylation of downstream targets including:

    • ERK1/2 (pERK1/2)

    • AKT (pAKT)

    • AMPK (pAMPK)

  • cAMP Assay: Monitor changes in cAMP levels following agonist stimulation.

  • β-Arrestin Recruitment: Assess receptor desensitization mechanisms using BRET or FRET-based assays.

  • Gene Expression Analysis: Measure changes in expression of target genes regulated by O3FAR1 activation:

    • Anti-inflammatory genes

    • Metabolic regulators

    • Insulin signaling components

This multi-parameter approach provides comprehensive insights into O3FAR1 functionality across different tissues and experimental conditions.

How does O3FAR1 signaling in hypothalamic neurons of Macaca fascicularis influence energy homeostasis?

O3FAR1 signaling in hypothalamic neurons of Macaca fascicularis plays a pivotal role in energy homeostasis regulation through multiple mechanisms. Similar to findings in related research, O3FAR1 expressed in hypothalamic neurons, particularly in proopiomelanocortin (POMC) neurons of the arcuate nucleus, functions as a critical nutrient sensor responding to circulating fatty acids . When activated by omega-3 fatty acids, this signaling cascade:

  • Decreases food intake by modulating neuropeptide expression patterns

  • Increases energy expenditure through sympathetic activation of brown adipose tissue

  • Enhances thermogenesis and promotes browning of subcutaneous white adipose tissue

  • Reduces hypothalamic inflammation and endoplasmic reticulum stress

  • Decreases AMP-activated protein kinase (AMPK) levels in the hypothalamus

Conversely, knockdown studies have demonstrated that Ffar1 deletion specifically in POMC neurons results in hyperphagia, increased body weight, and development of hepatic insulin resistance and steatosis . These findings position O3FAR1 as a potential therapeutic target for metabolic disorders, particularly those characterized by hypothalamic inflammation and energy imbalance.

What approaches should be used to analyze contradictory data when studying O3FAR1 function in inflammation pathways?

When encountering contradictory data regarding O3FAR1 function in inflammation pathways, researchers should implement a systematic analytical framework:

  • Data Verification and Quality Assessment:

    • Evaluate experimental design rigor and statistical power

    • Assess reagent specificity, particularly antibody validation

    • Verify knockdown/knockout efficiency and specificity

  • Context Evaluation:

    • Compare experimental conditions (ex vivo vs. in vivo)

    • Analyze tissue/cell-type specificity of effects

    • Consider temporal dynamics of inflammatory responses

  • Reconciliation Strategies:

    • Investigate potential dual signaling mechanisms (G-protein vs. β-arrestin pathways)

    • Examine ligand-specific effects (different omega-3 fatty acids may induce biased signaling)

    • Consider receptor heterogeneity and post-translational modifications

  • Advanced Validation Approaches:

    • Implement orthogonal methodologies to confirm findings

    • Conduct dose-response and time-course analyses

    • Utilize genetic models with tissue-specific manipulations

Analysis AspectPrimary ApproachSecondary Validation
Signaling PathwayWestern Blot (phospho-proteins)Transcriptional Reporter Assays
Inflammatory ResponseCytokine ProfilingImmune Cell Infiltration Analysis
Metabolic EffectsGlucose/Insulin ToleranceIndirect Calorimetry
Gene ExpressionqRT-PCRRNA-Seq or Proteomic Analysis

This structured approach facilitates the integration of seemingly contradictory data into a more comprehensive understanding of O3FAR1's nuanced roles in inflammation regulation.

How can researchers design experiments to elucidate the role of O3FAR1 in mediating cross-talk between metabolic and inflammatory pathways?

Designing experiments to elucidate O3FAR1's role in mediating cross-talk between metabolic and inflammatory pathways requires a multidisciplinary approach:

  • Conditional Gene Manipulation:

    • Generate tissue-specific O3FAR1 knockdown/knockout models using Cre-lox systems

    • Develop inducible expression systems to control temporal aspects of O3FAR1 activation

    • Create cell-type specific reporter lines to track O3FAR1-expressing cells

  • Metabolic-Inflammatory Challenge Models:

    • Implement lipopolysaccharide (LPS) challenge in metabolically characterized animals

    • Utilize high-fat diet paradigms with inflammatory endpoint analyses

    • Employ glucose/insulin challenges with parallel assessment of inflammatory markers

  • Molecular Interaction Studies:

    • Investigate O3FAR1 interaction with β-arrestin 2 and TAB1 using co-immunoprecipitation

    • Assess receptor internalization and trafficking during metabolic vs. inflammatory stimuli

    • Identify tissue-specific co-regulators using proteomics approaches

  • Translational Validation:

    • Compare findings between Macaca fascicularis models and human tissue samples

    • Validate key pathways using pharmacological agonists/antagonists

    • Correlate molecular signatures with physiological outcomes

This comprehensive experimental framework enables researchers to delineate the complex bidirectional communication between metabolic regulation and inflammatory processes mediated by O3FAR1.

What statistical approaches are most appropriate for analyzing O3FAR1 expression data across different tissues in Macaca fascicularis?

When analyzing O3FAR1 expression data across different tissues in Macaca fascicularis, researchers should implement tissue-appropriate statistical methodologies that account for biological variability and technical limitations:

  • Normalization Strategies:

    • For qPCR data: Multiple reference gene normalization (minimum 3 stable reference genes)

    • For RNA-seq: TPM/FPKM with appropriate batch correction

    • For protein quantification: Total protein normalization or housekeeping proteins verified for stability across tissues

  • Statistical Testing Framework:

    • For normally distributed data: One-way ANOVA with appropriate post-hoc tests

    • For non-parametric analysis: Kruskal-Wallis with Dunn's multiple comparisons

    • For paired tissue comparisons: Repeated measures approaches

  • Advanced Statistical Considerations:

    • Implement linear mixed models to account for within-subject correlations

    • Consider Bayesian approaches for small sample sizes

    • Employ false discovery rate correction for multiple tissue comparisons

  • Visualization Methods:

    • Heat maps for multi-tissue expression patterns

    • Principal component analysis for identifying tissue clustering

    • Network analysis for co-expression patterns

These approaches ensure robust interpretation of tissue-specific O3FAR1 expression patterns while minimizing false discoveries and accounting for the complex nature of primate tissue samples.

How should researchers address unexpected results when studying O3FAR1 ligand binding properties?

When confronting unexpected results in O3FAR1 ligand binding studies, researchers should implement a systematic troubleshooting and validation approach:

  • Technical Verification:

    • Validate protein integrity and proper folding

    • Verify ligand purity and stability under experimental conditions

    • Assess assay components for interference or degradation

  • Methodological Considerations:

    • Compare multiple binding assay technologies (radioligand, fluorescence, SPR)

    • Evaluate buffer conditions and their impact on receptor conformation

    • Assess temperature and time-dependent effects on binding kinetics

  • Biological Context Evaluation:

    • Investigate post-translational modifications affecting binding pocket

    • Consider allosteric modulators present in biological samples

    • Examine membrane composition effects on receptor function

  • Hypothesis Refinement:

    • Develop alternative models incorporating unexpected findings

    • Design confirmatory experiments testing refined hypotheses

    • Consider structural biology approaches to elucidate mechanism

Unexpected ResultPrimary InvestigationSecondary Validation
Reduced affinityVerify protein integrityStructural analysis of binding pocket
Multiple binding sitesSaturation binding with competitionSite-directed mutagenesis
Species differencesSequence alignment analysisChimeric receptor studies
Context-dependent bindingMembrane composition analysisNative tissue validation

This structured approach transforms unexpected results into opportunities for deeper mechanistic understanding of O3FAR1 ligand interactions.

What are the key considerations for translating O3FAR1 research findings from Macaca fascicularis models to human applications?

Translating O3FAR1 research findings from Macaca fascicularis to human applications requires careful consideration of species-specific differences and methodological limitations:

  • Molecular Comparison Framework:

    • Conduct detailed sequence homology analysis of receptor and signaling components

    • Compare binding profiles using recombinant human and Macaca fascicularis O3FAR1

    • Assess species-specific post-translational modifications and their functional impact

  • Physiological Context Evaluation:

    • Compare tissue distribution patterns between species

    • Analyze differential responses to dietary fatty acid profiles

    • Assess baseline inflammatory states and metabolic parameters

  • Pharmacological Considerations:

    • Evaluate species-specific pharmacokinetics of O3FAR1 agonists

    • Determine therapeutic window differences

    • Identify potential off-target effects unique to each species

  • Translation Strategies:

    • Design parallel studies in Macaca fascicularis and human tissues/cells

    • Develop humanized models for critical validation experiments

    • Establish biomarker profiles that translate between species

These systematic considerations facilitate responsible translation of preclinical findings to human applications while acknowledging the inherent limitations of model systems, ultimately enhancing the predictive value of Macaca fascicularis-based O3FAR1 research.

What emerging technologies could advance the study of O3FAR1 trafficking and signaling dynamics in Macaca fascicularis models?

Several cutting-edge technologies are poised to revolutionize our understanding of O3FAR1 trafficking and signaling dynamics in Macaca fascicularis models:

  • Advanced Imaging Modalities:

    • Super-resolution microscopy (STORM/PALM) for nanoscale visualization of receptor clustering

    • Light-sheet microscopy for 3D tissue analysis with reduced phototoxicity

    • FRET/BRET sensors for real-time monitoring of protein-protein interactions

  • Genome Editing Technologies:

    • CRISPR-Cas9 for precise genetic manipulation in primary Macaca cells

    • Base editing for introducing specific point mutations

    • Knock-in fluorescent tags for endogenous receptor visualization

  • Single-Cell Technologies:

    • scRNA-seq to identify O3FAR1-expressing cell populations

    • Spatial transcriptomics for tissue context preservation

    • CyTOF for multiplexed protein marker analysis

  • Computational Approaches:

    • Molecular dynamics simulations of receptor-ligand interactions

    • Machine learning for pathway interaction prediction

    • Systems biology modeling of signaling networks

These emerging technologies, applied in combination, will provide unprecedented insights into the spatiotemporal dynamics of O3FAR1 function across different tissues and physiological states in Macaca fascicularis models.

How can researchers design experiments to investigate the potential role of O3FAR1 in neurodegenerative processes?

To investigate O3FAR1's potential role in neurodegenerative processes, researchers should design multifaceted experimental approaches:

  • Expression Profiling in Neurodegeneration Models:

    • Quantify O3FAR1 expression in brain regions vulnerable to neurodegeneration

    • Analyze temporal changes during disease progression

    • Compare expression between affected and unaffected neurons

  • Functional Studies:

    • Assess O3FAR1 activation effects on neuroinflammatory markers

    • Evaluate impact on microglial and astrocyte activation states

    • Investigate influence on neuronal survival pathways

    • Analyze effects on autophagy and protein aggregation clearance

  • Intervention Studies:

    • Test O3FAR1 agonists in models of neurodegeneration

    • Evaluate outcomes using behavioral, histological, and molecular endpoints

    • Assess blood-brain barrier penetration of potential therapeutic compounds

  • Mechanistic Investigations:

    • Explore O3FAR1-mediated regulation of neuroinflammation

    • Study effects on oxidative stress responses

    • Investigate modulation of mitochondrial function

    • Assess impact on synaptic plasticity and neuronal connectivity

This comprehensive approach will illuminate the potential neuroprotective or neurodegenerative roles of O3FAR1, potentially establishing new therapeutic avenues for neurodegenerative disorders.

What collaborative research approaches would best advance understanding of O3FAR1's role across different physiological systems?

Advancing comprehensive understanding of O3FAR1's multisystem roles requires strategic interdisciplinary collaboration frameworks:

  • Multi-Omics Integration Initiatives:

    • Combine transcriptomics, proteomics, and metabolomics across tissues

    • Integrate epigenetic regulation data with functional outcomes

    • Develop computational pipelines for multi-dimensional data analysis

  • Translational Research Consortia:

    • Establish biobanks of matched Macaca and human samples

    • Develop standardized protocols for cross-species comparisons

    • Create shared resources for O3FAR1-specific tools and reagents

  • Technology-Biology Partnerships:

    • Collaborate with structural biologists for receptor conformation studies

    • Partner with medicinal chemists for ligand optimization

    • Engage bioengineers for advanced tissue modeling systems

  • Clinical Research Networks:

    • Connect basic O3FAR1 findings with clinical phenotypes

    • Identify genetic variants affecting receptor function in populations

    • Evaluate nutritional interventions targeting O3FAR1 pathways

This collaborative ecosystem approach accelerates discovery by leveraging diverse expertise, maximizing resource utilization, and ensuring findings are robustly validated across physiological contexts and species barriers, ultimately advancing translational applications of O3FAR1 research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.