Recombinant Macaca fascicularis Phosphatidylcholine:ceramide cholinephosphotransferase 2 (SGMS2)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Mechanism

SGMS2 operates bidirectionally at plasma membranes:

  • Forward reaction: Converts phosphatidylcholine (PC) and ceramide (Cer) into sphingomyelin (SM) and DAG .

  • Reverse reaction: Regenerates PC from SM and DAG .

Its activity influences:

  • Lipid gradients: Maintains SM/cholesterol asymmetry critical for membrane raft formation .

  • Signaling pathways: Modulates mitogenic DAG and proapoptotic Cer levels .

  • Bone mineralization: Disruptions in SGMS2 function correlate with osteoporosis due to ER lipid imbalances .

Disease Modeling

  • Osteoporosis: Pathogenic SGMS2 variants (e.g., p.Arg50*) mislocalize to the ER, altering SM/DAG ratios and collagen secretion . Recombinant SGMS2 aids in studying these variants' enzymatic impacts .

  • Cancer: Overexpression promotes breast cancer invasiveness via TGF-β/Smad signaling and EMT initiation .

Comparative Analysis of SGMS Isoforms

FeatureSGMS1SGMS2SMSr
Localizationtrans-GolgiPlasma membrane/GolgiER
ActivityMajor SM synthaseSecondary SM synthaseCeramide phosphoethanolamine
Disease LinksMitochondrial dysfunction Osteoporosis, glaucoma Not established

Challenges and Future Directions

  • Expression limitations: Native SGMS2 is faintly detectable in cell lines due to splice variants . Recombinant systems overcome this but require optimization for post-translational modifications.

  • Therapeutic targeting: SM/DAG imbalance in SGMS2-related diseases highlights potential for lipid-modulating therapies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please specify it when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SGMS2; QtsA-16184; Phosphatidylcholine:ceramide cholinephosphotransferase 2; Sphingomyelin synthase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-365
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
SGMS2
Target Protein Sequence
MDIIETAKLEEHLENQPSDPTNTYTRPTEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYI QIAMPTESRNKFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY IDRVKWAFSVSEINGIILVGLWITQWLFLRYKSIVGRRFCFIIGTLYLYRCITMYVTTLP VPGMHFQCAPKLNGDSQAKVQRILRLISGGGLSITGSHILCGDFLFSGHTVTLTLTYLFI KEYSPRHFWWYHLICWLLSAAGIICILVAHEHYTVDVIIAYYITTRLFWWYHSMANEKNL KVSLQTNFLSRAWWFPIFYFFEKNVQGSIPCCFSWPLSWPPGCFKSSCKKYSRVQKIGED NEKST
Uniprot No.

Target Background

Function
Sphingomyelin synthase primarily contributes to sphingomyelin synthesis and homeostasis at the plasma membrane. It catalyzes the reversible transfer of the phosphocholine moiety in sphingomyelin biosynthesis. In the forward reaction, it transfers the phosphocholine head group of phosphatidylcholine (PC) onto ceramide (CER) to form ceramide phosphocholine (sphingomyelin, SM) and diacylglycerol (DAG) as a byproduct. In the reverse reaction, it transfers phosphocholine from SM to DAG to form PC and CER. The direction of the reaction appears to depend on the levels of CER and DAG in the plasma membrane. It does not utilize free phosphorylcholine or CDP-choline as donors. It can also transfer the phosphoethanolamine head group of phosphatidylethanolamine (PE) onto ceramide (CER) to form ceramide phosphoethanolamine (CPE). It regulates receptor-mediated signal transduction via mitogenic DAG and proapoptotic CER, as well as via SM, a structural component of membrane rafts that serve as platforms for signal transduction and protein sorting. To a lesser extent, it plays a role in secretory transport via regulation of the DAG pool at the Golgi apparatus and its downstream effects on PRKD1. It is required for normal bone matrix mineralization.
Database Links

KEGG: mcf:101867034

UniGene: Mfa.2465

Protein Families
Sphingomyelin synthase family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the subcellular localization of SGMS2 and how does it differ from other sphingomyelin synthases?

SGMS2 (SMS2) is a multi-membrane spanning protein that primarily contributes to sphingomyelin synthesis and homeostasis at the plasma membrane . Unlike its counterpart SMS1, SGMS2 has a specific subcellular distribution. The wild-type SGMS2 localizes to both the Golgi apparatus and the plasma membrane, while pathogenic variants show altered localization patterns . For example, missense variants p.Ile62Ser and p.Met64Arg cause retention of the protein in the endoplasmic reticulum, while the p.Arg50* variant appears to mislocalize to the cis/medial Golgi .

For research applications, subcellular fractionation followed by western blotting or immunofluorescence microscopy using organelle-specific markers can be employed to track SGMS2 localization. When studying recombinant Macaca fascicularis SGMS2, it's essential to confirm its localization pattern matches expected distribution before proceeding with functional assays.

What are the key structural domains of SGMS2 that determine its functional properties?

SGMS2 contains multiple transmembrane domains with an N-terminal region that plays a crucial role in proper protein trafficking. The N-terminal portion of SGMS2 immediately upstream of transmembrane domain 1 (TMD1) contains critical residues that function as an ER export signal . Specifically, the IXMP sequence motif (where isoleucine at position 62 and methionine at position 64) is located 13-14 residues upstream of the first membrane span and constitutes part of this essential ER export signal .

For research involving recombinant SGMS2, it's crucial to ensure these structural domains remain intact during cloning and expression. Any modifications or tags should be positioned to avoid disrupting these functional regions. Site-directed mutagenesis experiments targeting these residues can provide valuable insights into structure-function relationships of the protein.

How can researchers effectively develop SGMS2 knockout or knockdown models to study its function?

Several approaches have been successfully used to generate SGMS2-deficient models:

  • Traditional knockout mice: Complete Sms2 knockout (KO) mice have been developed by multiple research groups, including Hailemariam et al. in 2008 and Mitsutake et al. in 2011 . These models have been utilized in multiple studies exploring the role of SGMS2 in metabolism and inflammation.

  • CRISPR-Cas systems: For zebrafish models, CRISPR-Cas13d has been effectively used to knockdown sgms2a, sgms2b, and sgms2a+b, resulting in defective cartilage and early skeletal element development compared to control fish .

  • siRNA-mediated knockdown: Studies have shown that siRNA-mediated SMS2 knockdown in mouse primary osteoblasts reduces expression of RXRα mRNA and RANKL after 1,25(OH)₂D stimulation .

When developing recombinant Macaca fascicularis SGMS2 models, researchers should consider species-specific differences in gene regulation and protein function. Validation of knockdown/knockout efficiency should be performed at both mRNA and protein levels, with functional assays to confirm altered sphingomyelin synthesis.

What are the comparative advantages of different animal models for studying SGMS2 function?

Table 1: Comparative Analysis of Animal Models for SGMS2 Research

Animal ModelAdvantagesLimitationsKey Applications
Sms2 KO Mice- Mammalian physiology
- Extensive validation in multiple studies
- Suitable for long-term phenotypic assessment
- Potential functional compensation by SMS1
- No obvious bone abnormalities reported in initial studies
- May require specific pathogenic variants rather than complete knockout
- Metabolic studies
- Inflammation research
- COPD models
Zebrafish (sgms2a/b)- Rapid development
- Transparent embryos allow visualization
- Similar skeletal elements and ossification types as mammals
- Behavioral phenotyping possible
- Differences in bone morphology and function compared to mammals
- Two orthologs (sgms2a and sgms2b) with potentially redundant functions
- Developmental skeletal studies
- Locomotor and behavioral assessment
- High-throughput screening
Cell Culture Systems- Precise mechanistic studies
- Human cell types available
- Suitable for high-throughput screening
- Lack of physiological context
- Limited for studying tissue interactions
- Subcellular localization studies
- Sphingolipid metabolism
- Signaling pathway analysis

For researchers working with recombinant Macaca fascicularis SGMS2, non-human primate cell lines may provide a closer model to human physiology than rodent systems, particularly for studies focused on bone pathophysiology or neurological manifestations .

How do different SGMS2 variants affect protein function and contribute to disease phenotypes?

Current evidence suggests that pathogenic SGMS2 variants lead to disease through altered subcellular localization rather than direct effects on enzymatic activity. The three main pathogenic variants (p.Arg50*, p.Ile62Ser, and p.Met64Arg) are all located in the N-terminal part of the protein .

The missense variants p.Ile62Ser and p.Met64Arg do not affect enzymatic activity but prevent SMS2 from exiting the endoplasmic reticulum due to disruption of the ER export signal . Transfection studies in HeLa cells have demonstrated that these variants are retained in the ER, while wild-type SGMS2 correctly localizes to the Golgi and plasma membrane .

The nonsense p.Arg50* variant is more complex. While initially predicted to result in a truncated enzyme lacking the entire transmembrane helices including active sites, some evidence suggests it may produce a shortened yet functional enzyme with methionine at position 64 serving as an alternative translation initiation site . This variant appears to be exported from the ER but mislocalizes to the cis/medial Golgi instead of reaching the plasma membrane .

When studying recombinant SGMS2, researchers should consider introducing these pathogenic variants through site-directed mutagenesis to investigate their effects on protein trafficking and function in relevant model systems.

What is the spectrum of clinical manifestations associated with SGMS2 dysfunction?

SGMS2 variants cause a spectrum of skeletal disorders with skeletal fragility as the primary manifestation. The clinical presentations range from:

  • Childhood-onset osteoporosis with low bone mineral density (BMD) and skeletal fragility with or without sclerotic doughnut-shaped lesions in the skull

  • Severe spondylometaphyseal dysplasia with neonatal fractures, long-bone deformities, and short stature

  • Neurological manifestations including facial nerve palsy

  • Ocular issues, particularly juvenile-onset open-angle glaucoma

The phenotypic severity appears variant-dependent. The p.Arg50* variant (more common) is associated with a milder phenotype, while p.Ile62Ser and p.Met64Arg variants lead to more severe manifestations including neonatal fractures, severe short stature, and spondylometaphyseal dysplasia .

Beyond skeletal manifestations, SGMS2 dysfunction has been implicated in respiratory physiology. Studies in Sgms2-deficient mice have demonstrated enhanced airway and tissue resistance after chronic cigarette smoke exposure, suggesting a role in pulmonary function and possibly COPD pathogenesis .

How does SGMS2 dysfunction alter cellular lipid composition and membrane properties?

SGMS2 variants disrupt the normal subcellular organization of sphingomyelin (SM) throughout the secretory pathway. This disruption appears to cause:

  • Accumulation of SM in the endoplasmic reticulum

  • Disrupted SM asymmetry at the plasma membrane

  • Altered ER glycerophospholipid profile, including increased phospholipid desaturation and elevated levels of cone-shaped ethanolamine-containing phospholipids

These alterations may represent cellular adaptations to SM-mediated rigidification of the ER bilayer . The combined effect severely impairs the cell's ability to maintain nonrandom lipid distributions in the secretory pathway, which appears crucial for proper osteogenic cell function and bone formation .

For researchers working with recombinant SGMS2, comprehensive lipidomic analyses comparing wild-type and variant forms can provide valuable insights into these alterations. Mass spectrometry-based approaches can quantify changes in specific lipid species across different cellular compartments.

What signaling pathways intersect with SGMS2 function in bone development and disease?

Several key signaling pathways appear to intersect with SGMS2 function:

  • Vitamin D and RXRα signaling: SGMS2 influences osteoclastogenesis through the 1,25(OH)₂D (vitamin D) pathway. Knockdown of SGMS2 in mouse primary osteoblasts reduces expression of RXRα mRNA and RANKL after 1,25(OH)₂D stimulation, significantly reducing the number of differentiated osteoclasts .

  • Collagen secretion pathway: SGMS2 dysfunction may impair the formation of secretory vesicles containing procollagen due to rigidification of the ER bilayer. This would prevent proper export of collagen from the ER and impact bone formation. The process involves coat protein complex type II (COPII) vesicles and the ER-resident transmembrane protein TANGO1, which is required for packaging procollagen fibers .

  • Bone mineralization mechanisms: SGMS2 may play a role in the formation of matrix vesicles that bud from osteoblasts' apical membrane and deposit phosphate and calcium at mineralization sites. Sphingomyelin metabolism in these vesicles appears critical for generating phosphate needed for hydroxyapatite formation .

For recombinant SGMS2 studies, phosphoproteomics approaches combined with specific pathway inhibitors can help delineate these signaling connections in relevant cell types.

What are the optimal expression systems for producing functional recombinant Macaca fascicularis SGMS2?

When expressing recombinant Macaca fascicularis SGMS2, several expression systems can be considered, each with distinct advantages:

  • Mammalian expression systems: HEK293T or CHO cells provide appropriate post-translational modifications and membrane insertion machinery. These systems are preferable for studies investigating protein trafficking, localization, and interaction with other mammalian proteins.

  • Insect cell expression: Baculovirus-infected Sf9 or High Five cells can produce higher protein yields while maintaining most post-translational modifications required for function.

  • Cell-free systems: For rapid screening of variants or mutants, cell-free expression systems supplemented with appropriate lipids and membranes can be utilized.

The choice of expression tag is critical - N-terminal tags should be avoided as they may interfere with the crucial ER export signal in the N-terminal region of SGMS2 . C-terminal tags (His, FLAG, or GFP) are preferable. Expression should be validated through western blotting, and functionality confirmed through sphingomyelin synthase activity assays measuring the conversion of ceramide and phosphatidylcholine to sphingomyelin and diacylglycerol.

What enzymatic assays can effectively measure SGMS2 activity in different experimental contexts?

Several approaches can be used to assess SGMS2 enzymatic activity:

  • Radiometric assays: Using radiolabeled substrates such as [³H]ceramide or [¹⁴C]phosphatidylcholine to measure the production of [³H]sphingomyelin or [¹⁴C]diacylglycerol. This approach offers high sensitivity but requires specialized equipment for handling radioactive materials.

  • Fluorescent substrate assays: Utilizing ceramide analogs with fluorescent tags that change spectral properties upon conversion to sphingomyelin.

  • Mass spectrometry-based assays: LC-MS/MS can quantify both substrates and products with high specificity, allowing detailed kinetic analysis and identification of specific molecular species.

  • In-cell activity assays: For assessing SGMS2 activity in its native environment, metabolic labeling with stable isotope-labeled precursors (e.g., ¹³C-serine) can track sphingolipid metabolism in living cells.

When working with recombinant SGMS2, it's essential to include appropriate controls, such as the catalytically inactive D348E mutant, to distinguish enzyme-specific activity from background reactions. Activity should be assessed across different pH values, temperatures, and substrate concentrations to determine optimal conditions and kinetic parameters.

How does SGMS2 dysfunction specifically affect bone mineralization at the cellular and molecular levels?

SGMS2 dysfunction appears to impact bone mineralization through several mechanisms:

  • Altered collagen processing and secretion: SGMS2 variants may impair the formation of secretory vesicles containing procollagen due to rigidification of the ER bilayer. This prevents proper export of collagen from the ER, affecting bone formation. Mutations in COPII components and TANGO1, which are required for packaging procollagen fibers into vesicles, have been shown to cause insufficient bone mineralization, suggesting a similar mechanism for SGMS2 .

  • Disrupted matrix vesicle formation: Bone mineralization depends on matrix vesicles that bud from osteoblasts' apical membrane to deposit phosphate and calcium at mineralization sites. Pathogenic SGMS2 variants may disturb sphingomyelin asymmetry at the plasma membrane, affecting this process .

  • Impaired phosphate generation: Sphingomyelinases like SMPD3 in matrix vesicles degrade sphingomyelin to produce phosphocholine, which can be utilized to provide phosphate for mineralization. Although SGMS2 cannot directly release phosphocholine, it may regenerate sphingomyelin from ceramide, refilling the sphingomyelin pool used by SMPD3. Dysfunction in this cycle could cause premature exhaustion of the lipid-based phosphate store needed for normal bone mineralization .

Bone biopsy analysis from patients with SGMS2 variants shows reduced mineral content, decreased bone volume, unorganized collagenous network, discorded collagenous apposition, enlarged osteocyte lacunae, and a distorted and short-spanned lacuna-canalicular network .

What methodological approaches can differentiate between direct and indirect effects of SGMS2 on bone phenotypes?

To distinguish direct from indirect effects of SGMS2 on bone phenotypes, researchers can employ:

  • Tissue-specific conditional knockout models: Using Cre-loxP systems with osteoblast-specific (Osx-Cre or Col1a1-Cre), osteoclast-specific (TRAP-Cre), or chondrocyte-specific (Col2a1-Cre) promoters to delete SGMS2 in specific cell types.

  • Co-culture systems: Combining wild-type and SGMS2-deficient osteoblasts, osteoclasts, and osteocytes in various combinations to identify cell-autonomous versus non-cell-autonomous effects.

  • Rescue experiments: Reintroducing wild-type or mutant SGMS2 into knockout backgrounds to determine which phenotypes can be rescued.

  • Time-resolved analyses: Conducting developmental time course studies to determine the sequence of cellular and molecular alterations preceding bone phenotypes.

  • Pharmacological approaches: Using specific inhibitors of sphingolipid metabolism or related signaling pathways to distinguish primary from secondary effects.

For recombinant Macaca fascicularis SGMS2 research, comparing the effects of wild-type and variant proteins in these systems can provide insights into species-specific aspects of SGMS2 function in bone biology.

How might novel gene editing approaches advance SGMS2 functional studies?

Recent advances in gene editing technologies offer promising approaches for SGMS2 research:

  • Base editing: For creating specific point mutations like those found in patients (p.Arg50*, p.Ile62Ser, and p.Met64Arg) without inducing double-strand breaks, potentially reducing off-target effects.

  • Prime editing: Offering precise genome editing capabilities to introduce specific mutations or correct existing ones in cellular and animal models.

  • CRISPR interference/activation (CRISPRi/CRISPRa): For modulating SGMS2 expression levels without altering the genomic sequence, allowing for temporal control of expression.

  • Inducible expression systems: Tetracycline-controlled or other inducible systems to study acute versus chronic effects of SGMS2 dysfunction.

  • Knockin reporter systems: Generating endogenous SGMS2-fluorescent protein fusions to track protein localization and dynamics in living cells and organisms.

These approaches could facilitate the development of more accurate disease models that better recapitulate the specific molecular defects observed in patients with SGMS2 variants, potentially leading to novel therapeutic strategies.

What are the emerging connections between SGMS2 dysfunction and neurological manifestations?

Beyond skeletal manifestations, emerging evidence suggests connections between SGMS2 and neurological function:

  • Patients with SGMS2 p.Arg50* mutations present with various neurological manifestations, including facial nerve palsy, as documented in clinical case reports .

  • SGMS2 knockdown zebrafish (sgms2a, sgms2b, sgms2a+b) at 6 days post-fertilization showed altered locomotor activity and behavioral responses to light/dark transition tests, suggesting a role in brain and nervous system function .

  • Potential connections to Parkinson's disease pathology exist through sphingomyelin metabolism pathways. Lysosomal pathways that degrade α-synuclein (a hallmark of Parkinson's disease) may be influenced by sphingomyelin metabolism, and variants in lysosomal acid sphingomyelinase have been reported to significantly increase the risk of Parkinson's disease .

Future research directions should include comprehensive neurological assessment of SGMS2 animal models, investigation of SGMS2 expression and function in neural tissues, and exploration of potential connections between sphingomyelin metabolism and neurodegeneration.

What are the most effective experimental design strategies for studying SGMS2 in translational research contexts?

Effective experimental design for SGMS2 translational research should incorporate:

  • Multi-level analysis: Integrating molecular, cellular, tissue, and organismal assessments to connect biochemical alterations with physiological outcomes.

  • Comparative studies: Examining multiple pathogenic variants (p.Arg50*, p.Ile62Ser, and p.Met64Arg) to understand genotype-phenotype correlations.

  • Temporal considerations: Investigating both developmental impacts and age-related changes in SGMS2 function and related phenotypes.

  • Therapeutic testing platforms: Developing high-throughput screening systems to identify compounds that could rescue trafficking defects or compensate for SGMS2 dysfunction.

  • Translational biomarkers: Identifying measurable indicators of SGMS2 activity or downstream effects that could serve as monitoring tools in clinical settings.

How can researchers effectively integrate SGMS2 studies with broader investigations of sphingolipid metabolism in disease?

To effectively integrate SGMS2 research within the broader context of sphingolipid metabolism:

  • Comprehensive lipidomic profiling: Employ mass spectrometry to analyze the complete sphingolipidome in relevant tissues, not just sphingomyelin levels.

  • Enzyme network analysis: Consider the interplay between SGMS2 and other sphingolipid-metabolizing enzymes, including sphingomyelinases, ceramide synthases, and sphingosine kinases.

  • Pathway flux analysis: Use stable isotope labeling to track the dynamic flow through sphingolipid metabolic pathways rather than just static levels.

  • Multiomic integration: Combine lipidomics with transcriptomics, proteomics, and metabolomics to identify coordinated responses to SGMS2 dysfunction.

  • Systems biology approaches: Apply computational modeling to predict how alterations in SGMS2 activity propagate through the sphingolipid network and affect cellular functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.