Recombinant Macaca fascicularis Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 (TPTE2)

Shipped with Ice Packs
In Stock

Description

Enzymatic Activity

TPTE2 acts as a lipid phosphatase, specifically removing the phosphate group from the D3 position of phosphatidylinositol 3,4,5-trisphosphate (PIP3) . This activity counteracts PIP3 accumulation, modulating downstream signaling pathways such as PI3K/AKT .

FunctionMechanismOutcome
PIP3 DephosphorylationHydrolyzes PIP3 → PIP2 at D3 position Reduces PIP3 signaling, antagonizing PI3K activity
Membrane LocalizationPTEN-C2 domain binds lipids Anchors enzyme to plasma membrane for substrate access

Comparison with PTEN

While PTEN dephosphorylates PIP3 at the D3 position, TPTE2 exhibits distinct structural differences, including four transmembrane (TM) domains absent in PTEN . This structural divergence suggests unique subcellular localization or regulatory mechanisms.

Functional Rescue in PTEN-Deficient Models

Overexpression of TPTE2 in PTEN-null MCF-10A breast epithelial cells rescues phenotypes associated with PTEN loss, including:

  • Growth Factor Independence: Restores sensitivity to growth factor deprivation .

  • Apoptosis Recovery: Increases annexin V binding (apoptosis marker) in nutrient-deprived conditions .

  • 3D Matrigel Viability: Reverses survival advantages in anchorage-independent growth .

Genomic and Evolutionary Insights

  • Species-Specific Variants: Macaca fascicularis TPTE2 orthologs differ from human SLCO transporters, highlighting species-specific metabolic adaptations .

  • Alternative Splicing: Exon skipping in PNPO (involved in vitamin B6 metabolism) correlates with TPTE2 expression patterns, suggesting regulatory crosstalk .

High-Resolution Genomic Mapping

Recent studies using haplotype-resolved assemblies of M. fascicularis genomes identified:

  • Segmental Duplications: ~42% lower than humans, with longer centromeres .

  • Complex Loci: ~240 Mbp regions linked to metabolic differences (e.g., CYP2C76, EHBP1L1) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
TPTE2; QtsA-17567; Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-566
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
TPTE2
Target Protein Sequence
MCRVMKASFSRKVKLELCLLSDCALLSSSSAPTNELSGTNLEAHINESPDPNALVGVIIE RSPSDSTQTNEFKGATKETLTIETPHSSECKGAGLLSPVSKSMLERLSKFEVEDAENVAS YDTKIKKIVRSIVSSFAFGIFGVFLVLLDVTLLLADLIFNDSKLYIPLVYRSISLAIALF FLMDVLLRVFVEGRQHYFSDLLNVLDTAIIVTPLLVDVVYIFFDIKFLRNIPRWIHLVRL LRLIILIRIFHLIHQKRELEKLMRRLVSENKRRYTRDGFDLDLTYVTERIIAMSFPSSGR QSFYRNPIEEVVRFLDKKHPNHYRVYNLCSERAYDPKYFHNRVSRIMIDDHNVPTLHEMV VFTKEVNEWMAQDPANIVAIHCKGGKGRTGTMICAFLIASEIFLTAEESLYYFGERRTDK TNSSKFQGVETPSQNRYVGYFAQVKHLYNWNLPPRRILFIKRFIIYSIRGVGTGGVCDLK VRIVMEKKVVFSSTSLGNCSILHDIETDRVLIDVFSGPPLYDDVKVQFFSSNLPKYYDNC PFFFWFNTSFIQSNRHILHSFRLVFT
Uniprot No.

Target Background

Function

This protein functions as a lipid phosphatase, specifically removing the phosphate group from the D3 position of the inositol ring in phosphatidylinositol 3,4,5-trisphosphate.

Database Links

UniGene: Mfa.3831

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is TPTE2 and what are its key structural features?

TPTE2, also known as TPIP (transmembrane phosphoinositide 3-phosphatase and tensin homolog 2), is a protein-coding gene located on chromosome 13. It functions as a phosphoinositide 3-phosphatase with structural homology to PTEN, a known tumor suppressor. The protein contains several key domains that define its function:

  • CDC14 protein tyrosine phosphatase domain that catalyzes the conversion of PIP3 to PIP2

  • PTEN-C2 domain, a lipid-binding region essential for localization to the inner plasma membrane

  • Four transmembrane (TM) domains in the N-terminal region that are absent in PTEN

These structural elements enable TPTE2 to function in phosphoinositide signaling pathways while maintaining a distinct localization pattern compared to PTEN .

What are the known transcript variants of TPTE2?

Research has identified at least three distinct TPTE2 transcript variants (TPTE2-1, TPTE2-2, and TPTE2-3), which differ in their N- and C-terminal regions. TPTE2-3 corresponds to TPIPγ, as identified in previous studies. Despite these variations, all three transcripts maintain the essential CDC14 phosphatase domain and PTEN-C2 domain required for catalytic activity and membrane localization. The TPTE2-1 variant shows the highest sequence homology to PTEN, particularly in the relative positioning of the CDC14 and C2 domains, making it a preferred candidate for functional studies examining complementation of PTEN activity .

What disease associations have been identified for TPTE2?

TPTE2 has been associated with several conditions, particularly those related to male reproductive health:

  • Male infertility with teratozoospermia due to single gene mutation

  • Multiple forms of spermatogenic failure (types 18, 19, 27, 39, 40, 42, 43, 45, 46, 49, 51, 65, 72)

  • X-linked spermatogenic failure (type 3)

These associations suggest TPTE2 plays a crucial role in spermatogenesis and male fertility .

What is the typical tissue expression pattern of TPTE2?

TPTE2 demonstrates a highly tissue-specific expression pattern. It is:

  • Highly expressed in the testes

  • Moderately expressed in spermatocytes

  • Found at lower levels in brain and stomach tissues

  • Expressed at negligible levels in other tissue types

This restricted expression pattern suggests specialized functions in reproductive and neurological tissues .

How does recombinant Macaca fascicularis TPTE2 differ from human TPTE2 in experimental systems?

When comparing recombinant Macaca fascicularis TPTE2 with human TPTE2 in experimental systems, researchers should consider several factors:

  • Sequence homology: While the Macaca fascicularis TPTE2 shares high sequence similarity with human TPTE2, species-specific amino acid differences exist that may affect epitope recognition in antibody-based applications.

  • Protein length: The full-length Macaca fascicularis TPTE2 protein consists of 566 amino acids, compared to the 522 amino acids of human TPTE2, suggesting potential structural or functional differences .

  • Expression systems: Both proteins can be expressed in E. coli expression systems with comparable yields, though post-translational modifications will differ from those in mammalian cells.

For cross-species experimental design, researchers should validate antibody cross-reactivity and consider potential functional differences when interpreting results from Macaca fascicularis TPTE2 as a model for human biology.

What methodologies are most effective for studying TPTE2 phosphatase activity in vitro?

Studying TPTE2 phosphatase activity requires specialized approaches due to its transmembrane nature and substrate specificity. Recommended methodologies include:

  • Phosphatase activity assays:

    • Use of synthetic phosphoinositide substrates (particularly PIP3)

    • Malachite green assays to quantify released phosphate

    • Fluorescence-based assays with specialized phosphatidylinositol substrates

  • Membrane preparation considerations:

    • Since TPTE2 contains four transmembrane domains, solubilization with appropriate detergents (CHAPS or Triton X-100) is critical

    • Alternative approaches include creating truncated versions that retain the CDC14 catalytic domain but lack transmembrane regions

  • Controls and validation:

    • Include catalytically inactive mutants (such as mutations in the CDC14 domain) as negative controls

    • Compare activity to recombinant PTEN as a reference enzyme

    • Validate substrate specificity across multiple phosphoinositide species

These methodological considerations are essential for accurately characterizing the enzymatic properties of TPTE2 .

How can TPTE2 be effectively overexpressed in mammalian cell systems for functional studies?

For successful overexpression of TPTE2 in mammalian cells:

  • Vector selection and construct design:

    • Use a CMV promoter-driven expression vector for strong expression

    • Consider fusion tags (GFP or other epitope tags) at either N- or C-terminus, with the C-terminus generally preferred to avoid interference with transmembrane domains

    • Include a flexible linker between TPTE2 and any fusion tag

  • Transfection and selection protocols:

    • Lipid-based transfection methods work effectively for most cell types

    • Establish stable transfectants using appropriate selection markers

    • Verify integration and expression by RT-PCR and immunoblotting

    • Confirm proper localization using immunofluorescence or fractionation techniques

  • Expression validation:

    • Use RT-PCR to quantify mRNA expression levels (2-3 fold increase over endogenous expression is typically sufficient for phenotypic studies)

    • Perform immunostaining with anti-TPTE2 or anti-tag antibodies to confirm protein expression and localization

    • Western blotting to confirm full-length protein expression

These approaches have successfully generated TPTE2 overexpression systems that demonstrated functional rescue of PTEN-deficient cells .

What functional assays are most informative for evaluating TPTE2's role in tumor suppression?

To evaluate TPTE2's tumor-suppressive functions, these assays provide complementary insights:

  • Wound healing and migration assays:

    • Modified scratch assays with and without growth factors

    • Time-lapse imaging to track closure rates

    • Quantitative analysis of migration distance and velocity

  • Cell viability and proliferation assays:

    • MTT reduction assays in growth factor-restricted conditions

    • BrdU incorporation for cell cycle analysis

    • Colony formation assays on plastic and in soft agar

  • Apoptosis and cell death measurements:

    • Annexin V binding studies to detect surface phosphatidylserine exposure

    • Caspase activation assays

    • TUNEL staining for DNA fragmentation

  • 3D culture models:

    • Growth in Matrigel to assess anchorage-independent survival

    • Spheroid formation assays

    • Morphological characterization of 3D structures

These assays have demonstrated that TPTE2 overexpression can reverse the cancer-associated phenotypes of PTEN-deficient cells, including normalizing accelerated wound healing, decreasing growth factor-independent proliferation, and restoring apoptotic potential .

How does TPTE2 interact with the PI3K/Akt signaling pathway, and what are the best methods to study this interaction?

TPTE2, like PTEN, functions as a phosphoinositide phosphatase that converts PIP3 to PIP2, thereby counteracting PI3K activity and potentially regulating Akt signaling. To study these interactions:

  • Phosphoinositide measurement techniques:

    • Mass spectrometry to quantify cellular PIP3/PIP2 ratios

    • Fluorescent PIP3-binding domain reporters for live cell imaging

    • Thin-layer chromatography of radiolabeled phosphoinositides

  • Downstream signaling analysis:

    • Phospho-specific antibodies to detect Akt activation (pSer473, pThr308)

    • Analysis of downstream targets like pGSK3β, pFOXO, and p27

    • Use of PI3K inhibitors (LY294002, wortmannin) as controls

  • Compartmentalization studies:

    • Membrane fractionation to determine TPTE2 localization

    • Co-localization with PIP3 sensors

    • FRET-based approaches for protein-lipid interactions

  • Genetic approaches:

    • Complementation studies in PTEN-null backgrounds

    • Phosphatase-dead TPTE2 mutants as controls

    • siRNA knockdown of endogenous TPTE2

These methodologies help elucidate whether TPTE2 functions analogously to PTEN in regulating PI3K/Akt signaling or has distinct roles based on its unique subcellular localization .

What are the challenges in purifying recombinant TPTE2 protein for structural and biochemical studies?

Purification of recombinant TPTE2 presents several challenges:

  • Solubility issues:

    • The presence of four transmembrane domains makes TPTE2 highly hydrophobic

    • Expression in E. coli often leads to inclusion body formation

    • Refolding from inclusion bodies may yield protein with compromised activity

  • Expression strategies:

    • Consider truncated constructs focusing on the catalytic domain

    • Use specialized E. coli strains with enhanced membrane protein expression capability

    • Explore eukaryotic expression systems (insect cells, yeast) for better folding

  • Purification approaches:

    • Two-phase detergent extraction methods

    • Affinity chromatography using His-tag or GST-tag followed by ion exchange

    • Size exclusion chromatography in the presence of appropriate detergents

  • Activity preservation:

    • Screen detergents compatible with phosphatase activity maintenance

    • Include stabilizing agents like glycerol or specific phospholipids

    • Minimize freeze-thaw cycles and store in small aliquots

Available commercial preparations demonstrate that purification is feasible, with proteins available in His-tagged or GST-tagged formats from E. coli expression systems .

How can researchers effectively use TPTE2 to rescue PTEN-deficient phenotypes?

Based on successful complementation studies with TPTE2 in PTEN-deficient models:

  • Experimental design considerations:

    • Select appropriate PTEN-null or PTEN-mutated cell lines

    • Establish stable TPTE2 overexpression at 2-3 fold physiological levels

    • Include both wild-type and phosphatase-dead TPTE2 controls

  • Phenotypic rescue assessment:

    • Measure multiple PTEN-dependent phenotypes (proliferation, migration, apoptosis sensitivity)

    • Quantify PI3K pathway outputs (phospho-Akt levels)

    • Assess growth factor dependency restoration

  • Optimization parameters:

    • Titrate TPTE2 expression levels to determine minimum required for rescue

    • Consider using inducible expression systems for temporal control

    • Test multiple TPTE2 isoforms (TPTE2-1 has shown highest homology to PTEN)

Experimental evidence shows that TPTE2 overexpression can effectively normalize multiple phenotypic changes associated with PTEN deficiency, including accelerated wound healing, increased division rates, abnormal adhesion, and reduced apoptosis sensitivity .

What controls should be included when performing functional studies with recombinant TPTE2?

Rigorous control strategies for TPTE2 functional studies include:

  • Protein expression controls:

    • Phosphatase-dead mutants (mutations in the catalytic CDC14 domain)

    • Empty vector controls

    • Tagged but catalytically active protein controls to account for tag effects

  • Experimental system controls:

    • Wild-type cells alongside mutant lines

    • Dose-response studies with varying expression levels

    • Complementary knockdown approaches

  • Phenotypic assessment controls:

    • Positive controls using known PTEN rescue

    • Include additional phosphatases with distinct substrate specificity

    • Time course measurements to distinguish immediate vs. adaptive effects

  • Validation approaches:

    • Combine overexpression with specific inhibitors of downstream pathways

    • Test multiple TPTE2 isoforms to confirm specificity

    • Cross-validate observations using multiple assay systems

These control strategies enhance the reliability and interpretability of functional studies involving TPTE2 .

How can TPTE2 expression be accurately quantified in experimental systems?

For precise quantification of TPTE2 expression:

  • mRNA quantification methods:

    • RT-PCR with isoform-specific primers

    • Digital PCR for absolute quantification

    • RNA-Seq for transcriptome-wide context

  • Protein detection approaches:

    • Western blotting using validated anti-TPTE2 antibodies

    • Quantitative immunofluorescence with appropriate controls

    • Mass spectrometry-based proteomics

  • Experimental benchmarks:

    • Compare expression to tissues with known high expression (testes)

    • Normalize to housekeeping genes or proteins

    • Include recombinant protein standards for absolute quantification

  • Considerations for tagged constructs:

    • Validate detection limit and linear range for fusion proteins

    • Confirm tag does not interfere with protein stability

    • Compare results using antibodies against both tag and native protein

Using these approaches, researchers have successfully quantified TPTE2 expression showing 2-3 fold overexpression compared to endogenous levels in experimental systems .

What approaches are recommended for studying TPTE2's subcellular localization?

To accurately characterize TPTE2's subcellular distribution:

  • Imaging approaches:

    • Confocal microscopy of fixed cells using anti-TPTE2 antibodies or fluorescent fusion proteins

    • Live cell imaging with TPTE2-GFP fusions

    • Super-resolution microscopy for detailed membrane distribution

  • Biochemical fractionation:

    • Differential centrifugation to separate membrane compartments

    • Density gradient separation

    • Detergent resistance membrane fractionation

  • Co-localization studies:

    • Dual labeling with organelle markers (ER, Golgi, plasma membrane)

    • PIP2/PIP3 co-detection using specific probes

    • Proximity ligation assays for protein interactions

  • Trafficking studies:

    • Photoactivatable or photoconvertible TPTE2 fusions

    • FRAP (Fluorescence Recovery After Photobleaching) for dynamics

    • Inhibitor treatments to disrupt specific trafficking pathways

Studies have shown that TPTE2-GFP fusion proteins display diffuse cytoplasmic distribution with potential membrane association, consistent with its function as a phosphoinositide phosphatase .

How does TPTE2 function compare to other PTEN family members in experimental systems?

Comparative analysis between TPTE2 and other PTEN family members reveals important functional distinctions:

FeaturePTENTPTE2TPTE
Membrane DomainsNoneFour transmembrane domainsMultiple transmembrane domains
Tissue ExpressionUbiquitousPrimarily testes, brain, stomachPrimarily testes
Subcellular LocalizationCytoplasmic/MembraneTransmembraneTransmembrane
Catalytic ActivityPIP3 → PIP2PIP3 → PIP2Limited phosphatase activity
Tumor Suppressor FunctionWell-establishedEmerging evidenceLimited evidence
Knockout PhenotypeEmbryonic lethalViable with fertility defectsNot fully characterized

These differences suggest that while TPTE2 can functionally complement PTEN in certain contexts, it likely has evolved specialized roles in reproductive tissues. The transmembrane domains of TPTE2 may restrict its activity to specific membrane compartments, unlike the more mobile PTEN .

What are the implications of TPTE2 research for developing novel cancer therapeutics?

TPTE2 research has revealed several potential therapeutic applications:

  • Therapeutic concept development:

    • Upregulation of TPTE2 as a strategy to compensate for PTEN loss in cancers

    • Identification of compounds that enhance TPTE2 expression or activity

    • Development of tissue-specific TPTE2 delivery approaches

  • Target validation approaches:

    • Analysis of TPTE2 expression correlation with cancer outcomes

    • Testing TPTE2 overexpression in patient-derived xenografts

    • Evaluation in combination with existing PI3K pathway inhibitors

  • Drug discovery opportunities:

    • Screens for small molecules that upregulate endogenous TPTE2

    • Structure-based design of TPTE2 activators

    • Development of membrane-permeable phosphoinositide analogs that enhance TPTE2 activity

Research has demonstrated that TPTE2 overexpression can normalize multiple cancer-associated phenotypes in PTEN-deficient cells, suggesting that pharmacological upregulation of TPTE2 could potentially reverse aspects of the tumorigenic and metastatic phenotype in PTEN-mutated cancers .

What are the most promising methodological advances for studying TPTE2 function in complex biological systems?

Emerging technologies with particular promise for TPTE2 research include:

  • CRISPR/Cas9 applications:

    • Generation of isoform-specific knockouts

    • Knock-in of tagged endogenous TPTE2

    • CRISPRa/CRISPRi for modulating endogenous expression

  • Advanced imaging approaches:

    • Lattice light-sheet microscopy for dynamic localization studies

    • Single-molecule tracking of TPTE2 in membranes

    • Correlative light and electron microscopy for ultrastructural context

  • Phosphoinositide sensors:

    • Genetically encoded biosensors for real-time PIP3/PIP2 ratio monitoring

    • Optogenetic tools for acute manipulation of phosphoinositide pools

    • Mass spectrometry imaging of phosphoinositides

  • Organoid and in vivo models:

    • Testicular organoids to study TPTE2 in its native high-expression context

    • Conditional TPTE2 transgenic mouse models

    • Patient-derived cancer organoids with PTEN mutations

These methodological advances will help address fundamental questions about TPTE2's physiological roles and therapeutic potential in cancer and reproductive disorders .

How can researchers address the challenge of TPTE2's tissue-specific expression when studying its function in diverse cell types?

To overcome limitations associated with TPTE2's restricted expression pattern:

  • Expression system selection:

    • Use cell types with natural TPTE2 expression as experimental models (testicular cell lines)

    • Establish conditional expression systems in non-expressing cells

    • Consider primary cultures from high-expressing tissues

  • Functional domain analysis:

    • Create chimeric proteins combining TPTE2 catalytic domains with alternative targeting signals

    • Express minimal functional domains in diverse cell types

    • Compare activity of different TPTE2 isoforms

  • Comparative approaches:

    • Parallel analysis with other phosphatases (PTEN, TPTE)

    • Cross-species comparison of TPTE2 orthologs

    • Relate tissue-specific effects to expression levels

  • Computational prediction:

    • Use structural modeling to predict tissue-specific interaction partners

    • Analyze tissue-specific post-translational modifications

    • Correlate expression patterns with pathway components across tissues

These strategies can help extrapolate TPTE2 functions observed in high-expressing tissues to broader biological contexts and therapeutic applications .

What are the key specifications for commercially available recombinant Macaca fascicularis TPTE2?

Commercial recombinant Macaca fascicularis TPTE2 proteins have the following specifications:

SpecificationDetails
Source OrganismMacaca fascicularis
Expression SystemE. coli
Protein LengthFull Length (1-566 amino acids)
Molecular Weight~64 kDa
Purity>90% by SDS-PAGE
TagsHis-Tag (C-terminal)
Endotoxin Level<1.0 EU/μg
FormulationPBS, pH 7.4, 10% glycerol
StorageAliquot and store at -80°C
ApplicationsEnzymatic assays, antibody production, protein interaction studies

Researchers should note that recombinant protein produced in E. coli will lack mammalian post-translational modifications, which may affect certain functional aspects of the protein .

What research tools are available for studying TPTE2 in experimental systems?

The research community has access to various tools for TPTE2 investigation:

  • Genetic reagents:

    • cDNA clones for multiple TPTE2 isoforms

    • Expression vectors with CMV promoters

    • siRNA/shRNA targeting TPTE2

    • CRISPR/Cas9 reagents for gene editing

  • Antibodies and detection reagents:

    • Polyclonal and monoclonal antibodies against TPTE2

    • Phospho-specific antibodies for downstream signaling

    • Fluorescent phosphoinositide probes

  • Cell models:

    • PTEN-deficient cell lines for complementation studies

    • Cells with stable TPTE2 overexpression

    • Primary cells from tissues with natural TPTE2 expression

  • Assay systems:

    • In vitro phosphatase assays

    • Cell-based phenotypic assays (wound healing, proliferation)

    • 3D culture systems for morphological studies

When designing experiments, researchers should carefully validate these tools for specificity and functionality in their particular experimental context .

What are the recommended storage and handling conditions for maintaining TPTE2 protein stability?

To maintain optimal activity of recombinant TPTE2:

  • Storage conditions:

    • Store at -80°C for long-term preservation

    • Avoid repeated freeze-thaw cycles by preparing single-use aliquots

    • Include 10-20% glycerol as a cryoprotectant

  • Working solution preparation:

    • Thaw rapidly at room temperature or 37°C

    • Keep on ice once thawed

    • Dilute in buffers containing stabilizing agents (BSA, glycerol)

  • Buffer considerations:

    • Maintain pH between 7.0-7.5

    • Include appropriate detergents for transmembrane protein stability

    • Add reducing agents (DTT or β-mercaptoethanol) to prevent oxidation of cysteine residues

  • Activity preservation:

    • Perform activity assays immediately after thawing when possible

    • Monitor activity over time to establish stability windows

    • Consider flash-freezing working aliquots in liquid nitrogen

Following these guidelines will help maintain TPTE2 structural integrity and enzymatic activity for experimental applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.