Recombinant Macaca fascicularis Potassium voltage-gated channel subfamily V member 1 (KCNV1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
KCNV1; QccE-20536; Potassium voltage-gated channel subfamily V member 1; Voltage-gated potassium channel subunit Kv8.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-500
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
KCNV1
Target Protein Sequence
MPSSGRALLDSPLDSGSLTSLDSSVFCSEGEGEPLALGDCFTVNVGGSRFVLSQQALSCF PHTRLGKLAVVVASYRRPGALAAVPSPLELCDDANPVDNEYFFDRSSQAFRYVLHYYRTG RLHVMEQLCALSFLQEIQYWGIDELSIDSCCRDRYFRRKELSETLDFKKDTEDQESQHES EQDFSQGPCPTVRQKLWNILEKPGSSTAARIFGVISIIFVVVSIINMALMSAELSWLDLQ LLEILEYVCISWFTGEFVLRFLCVRDRCRFLRKVPNIIDLLAILPFYITLLVESLSGSQT TQELENVGRIVQVLRLLRALRMLKLGRHSTGLRSLGMTITQCYEEVGLLLLFLSVGISIF STVEYFAEQSIPDTTFTSVPCAWWWATTSMTTVGYGDIRPDTTTGKIVAFMCILSGILVL ALPIAIINDRFSACYFTLKLKEAAVRQREALKKLTKNIATDSYISVNLRDVYARSIMEML RLKGRERASTRSSGGDDFWF
Uniprot No.

Target Background

Function

Potassium channel subunit that does not independently form functional channels. It modulates the activity of KCNB1 and KCNB2 channels by shifting the inactivation threshold to more negative potentials and slowing the inactivation rate. It may also downregulate the channel activity of KCNB1, KCNB2, KCNC4, and KCND1, potentially by retaining them within intracellular membranes.

Database Links

KEGG: mcf:102134648

UniGene: Mfa.727

Protein Families
Potassium channel family, V (TC 1.A.1.2) subfamily, Kv8.1/KCNV1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is KCNV1 and what is its primary function in non-human primates?

KCNV1, also known as Potassium voltage-gated channel subfamily V member 1 or Kv8.1, is a voltage-gated potassium channel that plays a critical role in the repolarization phase of neuronal action potentials . In Macaca fascicularis (cynomolgus monkey), this protein is encoded by the KCNV1 gene with UniProt ID Q9GKU7 .

When studying KCNV1 in Macaca fascicularis models, researchers should account for this modulatory role rather than treating it as an independent channel-forming protein.

How does KCNV1 differ between Macaca fascicularis and human models?

The human and Macaca fascicularis KCNV1 proteins share significant homology but have several notable differences:

FeatureHuman KCNV1Macaca fascicularis KCNV1
UniProt IDQ6PIU1 Q9GKU7
Length500 amino acids 500 amino acids
Transmembrane domains6 6 (presumed similar)
Expression patternLimited to brain Similar brain expression pattern
Functional capabilityCannot form channels independently Cannot form channels independently
Modulatory effectsModulates KCNB1, KCNB2, KCNC4, KCND1 Primarily documented for KCNB1, KCNB2

Despite these similarities, researchers should be cautious when extrapolating findings between species. The subtle amino acid differences between human and Macaca fascicularis KCNV1 may impact protein-protein interactions, modulatory capabilities, and pharmacological responses. When designing experiments, these species-specific differences should be accounted for, particularly in drug development or when studying specific channel modulators.

Methodologically, when working with either human or Macaca fascicularis KCNV1, the experimental approach should include co-expression with its partner subunits (KCNB1 or KCNB2) to observe functional effects.

What experimental systems are most suitable for studying recombinant Macaca fascicularis KCNV1?

For studying recombinant Macaca fascicularis KCNV1, several experimental systems have proven effective, each with specific advantages for different research questions:

Experimental SystemApplicationsMethodological Considerations
Chinese Hamster Ovary (CHO) cellsWhole-cell electrophysiology, trafficking studiesSimilar to systems used for KCNQ channels ; allows controlled expression
HEK293 cellsProtein-protein interactions, pharmacological studiesGood transfection efficiency; suitable for co-expression with KCNB1/KCNB2
Xenopus oocytesTwo-electrode voltage clamp, expression of multiple subunitsUseful for studying heteromeric channels; longer expression time
Neuronal cell lines (e.g., U-87 MG)Native-like environment, signaling studiesPositive control in Western blot applications ; complex background

When designing experiments with these systems, researchers should consider the following methodological approaches:

  • For electrophysiology studies: Co-express KCNV1 with KCNB1 or KCNB2 to observe functional modulation, as KCNV1 cannot form functional channels alone .

  • For protein expression verification: Western blot analysis with specific antibodies at dilutions of 1:2000-1:10000, using positive controls such as mouse brain tissue, rat brain tissue, or U-87 MG cells .

  • For trafficking studies: Consider techniques like biotinylation assays or total internal reflection fluorescence microscopy, which have been effective for studying similar potassium channels .

The choice of system should align with specific research objectives and the particular properties of KCNV1 being investigated.

How can researchers effectively analyze the modulatory effects of KCNV1 on other potassium channels?

Analyzing the modulatory effects of KCNV1 on other potassium channels requires sophisticated experimental approaches that capture both biophysical and functional aspects of channel behavior. Since KCNV1 cannot form functional channels by itself but modulates KCNB1 and KCNB2 channels , the following methodological framework is recommended:

  • Co-expression Systems Setup:

    • Establish expression systems with controlled ratios of KCNV1 to target channels (KCNB1, KCNB2, KCNC4, KCND1)

    • Use tetracycline-inducible systems to modulate expression levels precisely

    • Include fluorescent tags on different subunits to verify co-expression and co-localization

  • Electrophysiological Analysis:

    • Perform detailed voltage-clamp protocols focusing on:

      • Shifts in voltage-dependent activation and inactivation curves

      • Changes in activation and deactivation kinetics

      • Alterations in single-channel conductance properties

    • Single-channel analysis to determine:

      • Open probability (P₀) changes (similar to analysis methods used for KCNQ channels )

      • Dwell time distributions before and after KCNV1 co-expression

      • Modal gating behavior alterations

  • Biochemical Interaction Analysis:

    • Co-immunoprecipitation to confirm physical interaction between KCNV1 and target channels

    • FRET or BRET assays to study the dynamics of subunit interactions

    • Surface biotinylation to measure changes in channel trafficking and membrane expression

The key parameters to quantify include:

  • The magnitude of negative shift in inactivation threshold

  • The percentage decrease in inactivation rate

  • Changes in maximal open probability

  • Alterations in surface expression of partner channels

When interpreting results, researchers should consider that effects may be concentration-dependent and vary with the relative expression levels of KCNV1 versus its partner channels.

What are the most effective methods for studying KCNV1 electrophysiological properties in heterologous expression systems?

Studying the electrophysiological properties of KCNV1 in heterologous systems requires specialized approaches due to its unique characteristic of being a modulatory rather than channel-forming subunit. The following methodological framework provides the most effective approach:

  • Expression System Selection and Optimization:

    • Chinese Hamster Ovary (CHO) cells offer advantages similar to those demonstrated with KCNQ channels

    • Transfection protocol optimization: Use lipofection for transient expression or develop stable cell lines for consistent expression levels

    • Co-transfection ratios: Establish optimal KCNV1:KCNB1/KCNB2 ratios (typically 1:1 to 1:4) to observe physiologically relevant modulation

  • Whole-Cell Patch Clamp Protocols:

    • Voltage step protocols (holding at -80mV with steps from -100mV to +60mV)

    • Tail current analysis to determine voltage dependence of activation

    • Steady-state inactivation protocols using pre-pulses followed by test pulses

    • Recovery from inactivation using two-pulse protocols with varying interpulse intervals

  • Single-Channel Recording Approaches:

    • Inside-out or outside-out patch configurations to access intracellular modulators

    • Analysis of unitary conductance (expected to be in 2-8 pS range based on related channels )

    • Idealization of single-channel data using half-amplitude threshold detection

    • Burst analysis with critical closed-time criterion determination

  • Data Analysis Parameters:

    • Voltage for half-maximal activation (V₁/₂)

    • Slope factor (k) of activation/inactivation curves

    • Time constants of activation (τₐ) and inactivation (τᵢ)

    • Maximum open probability (P₀,max)

ParameterKCNB1 aloneKCNB1 + KCNV1Expected Change
V₁/₂ activation-15 to -5 mV-25 to -15 mVNegative shift
V₁/₂ inactivation-40 to -30 mV-60 to -50 mVNegative shift
τᵢ at +40mV50-100 ms150-300 msSlowed inactivation
P₀,max0.7-0.90.3-0.6Reduction

These experimental approaches should be combined with computational modeling to develop a comprehensive understanding of how KCNV1 alters channel gating mechanisms at the molecular level.

What are the challenges and solutions for ensuring proper folding and functional expression of recombinant Macaca fascicularis KCNV1?

Ensuring proper folding and functional expression of recombinant Macaca fascicularis KCNV1 presents several unique challenges due to its complex transmembrane structure and its inability to form functional channels independently. Research teams must address these challenges with sophisticated methodological approaches:

Challenges and Solutions Matrix:

ChallengeUnderlying MechanismMethodological Solution
Misfolding of transmembrane domainsComplex membrane insertion process for 6 transmembrane segmentsUse specialized expression vectors with optimized signal sequences; expression at lower temperatures (28-30°C)
Aggregation during expressionHydrophobic interactions between transmembrane domainsInclude chemical chaperones (glycerol, DMSO at low concentrations); co-express with molecular chaperones
Low surface expressionRetention in ER due to quality control mechanismsUse mammalian expression systems with appropriate trafficking machinery; optimize codon usage for Macaca fascicularis proteins
Difficulty verifying functional expressionCannot form functional channels alone Co-express with KCNB1/KCNB2 and measure modulatory effects; use reporter-tagged constructs to track localization
Post-translational modification differencesSpecies-specific glycosylation patternsSelect expression systems with similar glycosylation machinery; consider enzymatic deglycosylation if necessary

Verification Methodology:

  • Biochemical Verification:

    • Western blot analysis using specific KCNV1 antibodies (recommended dilution 1:2000-1:10000)

    • Immunoprecipitation to verify protein integrity

    • Surface biotinylation to confirm membrane localization

  • Structural Verification:

    • Circular dichroism to assess secondary structure

    • Limited proteolysis to verify domain folding

    • Fluorescence size-exclusion chromatography to assess aggregation state

  • Functional Verification:

    • Co-expression with KCNB1/KCNB2 followed by electrophysiological recording

    • Measure expected modulation effects (negative shift in inactivation threshold, slowed inactivation rate)

    • Use of chemical modifiers like N-ethylmaleimide (NEM) which have known effects on similar channels

When working with recombinant KCNV1, researchers should implement quality control checkpoints at each stage of expression and purification, with particular attention to detergent selection if membrane extraction is performed. The storage buffer should include 50% glycerol and be maintained at -20°C for optimal stability .

How can researchers effectively study the protein-protein interactions between KCNV1 and other channel subunits?

Investigating protein-protein interactions between KCNV1 and its partner subunits (primarily KCNB1 and KCNB2) requires a multi-faceted approach combining biochemical, biophysical, and imaging techniques. Since these interactions are fundamental to understanding KCNV1's modulatory function , the following comprehensive methodology is recommended:

1. Biochemical Interaction Analysis:

  • Co-immunoprecipitation (Co-IP):

    • Use antibodies specific to KCNV1 (such as recombinant antibody catalog number 85153-3-RR)

    • Validate with reciprocal pull-downs using antibodies to partner channels

    • Analyze under different detergent conditions to preserve interaction integrity

  • Crosslinking Mass Spectrometry:

    • Apply chemical crosslinkers of varying spacer lengths

    • Digest and analyze by LC-MS/MS to identify interaction interfaces

    • Map crosslinked residues to structural models to identify binding domains

  • Yeast Two-Hybrid and Split-Ubiquitin Assays:

    • Test domain-specific interactions using truncated constructs

    • Map minimal interaction domains required for subunit assembly

2. Real-time Interaction Dynamics:

  • FRET/BRET Approaches:

    • Tag KCNV1 and partner subunits with appropriate fluorophore/bioluminescent pairs

    • Measure energy transfer efficiency in living cells

    • Calculate binding affinities from saturation curves

  • Single-Molecule Tracking:

    • Label subunits with quantum dots or photoswitchable fluorophores

    • Track co-diffusion and co-confinement in plasma membrane

    • Analyze dwell times in interaction states

3. Structural Analysis Techniques:

  • Cryo-EM of Heteromeric Complexes:

    • Purify KCNV1-containing channel complexes with partner subunits

    • Determine 3D structure at near-atomic resolution

    • Identify structural changes induced by KCNV1 incorporation

  • Hydrogen-Deuterium Exchange Mass Spectrometry:

    • Compare deuterium uptake patterns between homomeric and heteromeric channels

    • Identify regions with altered solvent accessibility due to subunit interactions

4. Functional Correlation Analysis:

Interaction ParameterFunctional ReadoutExpected Correlation
Binding affinityShift in inactivation thresholdHigher affinity = larger negative shift
StoichiometryDegree of inactivation slowingHigher KCNV1:KCNB ratio = greater slowing
Interaction domain integrityChannel trafficking efficiencyDisrupted interaction = reduced surface expression
C-terminal interactionModulation of open probabilityC-terminus mutations = altered P₀ effects

When designing interaction studies, researchers should consider creating chimeric constructs between KCNV1 and non-interacting channel subunits to identify critical interaction determinants. This approach has been successful in identifying C-terminal regions responsible for functional effects in other K⁺ channels .

What approaches can be used to investigate the role of KCNV1 in neurological disorders using Macaca fascicularis models?

Investigating the role of KCNV1 in neurological disorders using Macaca fascicularis models requires sophisticated approaches that leverage the close evolutionary relationship between macaques and humans while addressing the ethical and methodological complexities of non-human primate research. Given that KCNV1 variations have been associated with human neurological conditions such as schizophrenia , the following research framework would be most effective:

1. Genetic and Molecular Profiling:

  • Comparative Genomic Analysis:

    • Sequence KCNV1 across multiple macaque individuals to identify natural variants

    • Compare with human variants associated with neurological disorders

    • Perform haplotype mapping to identify conserved regulatory elements

  • Expression Profiling:

    • Quantify KCNV1 expression across brain regions using qPCR and RNAscope

    • Compare expression patterns in neurotypical vs. naturally occurring behavioral phenotypes

    • Conduct single-cell transcriptomics to identify cell-type specific expression

2. Functional Characterization in Primary Neurons:

  • Ex Vivo Electrophysiology:

    • Acute brain slice preparations from specific regions (prefrontal cortex, hippocampus)

    • Patch-clamp recording of neuronal excitability parameters

    • Pharmacological isolation of K⁺ currents modulated by KCNV1

  • Viral-Mediated Manipulation:

    • AAV-based overexpression or knockdown of KCNV1 in specific brain regions

    • CRISPR-Cas9 approaches for targeted mutation introduction

    • Optogenetic tagging of KCNV1-expressing neurons for functional circuit mapping

3. Imaging and Circuit Analysis:

  • Structural and Functional MRI:

    • Compare brain structure and connectivity in animals with KCNV1 variants

    • Task-based fMRI during cognitive challenges relevant to neurological disorders

    • Pharmacological MRI with compounds that interact with K⁺ channels

  • Two-Photon Calcium Imaging:

    • In vivo imaging of neuronal activity in KCNV1-expressing circuits

    • Assess impact of KCNV1 manipulation on network dynamics

    • Correlate with behavioral readouts

4. Behavioral and Cognitive Assessment:

DomainTest ParadigmRelevance to Neurological Disorders
Working memoryDelayed match-to-sampleCognitive symptoms in schizophrenia
Sensory gatingPrepulse inhibitionSensorimotor filtering deficits
Social cognitionSocial interaction testsSocial withdrawal in psychiatric conditions
Executive functionReversal learning tasksCognitive flexibility impairments

5. Translational Biomarker Development:

  • EEG/MEG Signatures:

    • Identify electrophysiological markers associated with KCNV1 variants

    • Develop cross-species biomarkers translatable to human studies

    • Test responses to channel modulators as potential therapeutic approaches

When conducting this research, investigators must carefully balance scientific objectives with ethical considerations for non-human primate studies, prioritizing approaches that maximize information while minimizing the number of animals used. Complementary approaches using induced pluripotent stem cells derived from macaques with specific KCNV1 variants may provide additional insights while reducing reliance on animal models.

How should expression systems be optimized for recombinant Macaca fascicularis KCNV1 production?

Optimizing expression systems for recombinant Macaca fascicularis KCNV1 requires careful consideration of multiple factors to ensure proper folding, post-translational modifications, and functional integrity of this complex transmembrane protein. The following methodological framework addresses key optimization parameters:

1. Expression Vector Selection and Design:

  • Promoter Considerations:

    • For mammalian expression: CMV promoter offers high expression; EF1α provides more stable long-term expression

    • For insect cell expression: polyhedrin or p10 promoters in baculovirus systems

    • For bacterial systems: T7 promoter with tight regulation to prevent toxicity

  • Fusion Tag Strategy:

    • N-terminal tags: His6, FLAG, or SUMO tags to aid purification

    • C-terminal tags: Avoid if possible as C-terminus is critical for KCNV1 function

    • Cleavable linkers: TEV or PreScission protease sites for tag removal

    • Fluorescent protein fusions: For trafficking and localization studies

2. Expression Host Optimization:

Expression HostAdvantagesLimitationsOptimization Strategies
HEK293/CHO cellsNative-like post-translational modifications; proper membrane targetingLower yield; higher costStable cell line development; growth in suspension; optimize transfection conditions
Sf9/Hi5 insect cellsHigher protein yield; suitable for structural studiesDifferent glycosylation patternsOptimize MOI; harvest timing; supplementation with chaperones
E. coliHigh yield; cost-effectiveLack of post-translational modifications; inclusion body formationUse specialized strains (C41/C43); low temperature expression; fusion with solubility enhancers
Cell-free systemsRapid production; avoids toxicity issuesLower yield for membrane proteinsSupplement with microsomes or nanodiscs; optimize detergent conditions

3. Expression Condition Optimization:

  • Temperature Modulation:

    • Reduce to 28-30°C in mammalian/insect cells to improve folding

    • 16-18°C for E. coli expression to reduce inclusion body formation

  • Chemical Additives:

    • Glycerol (5-10%) to stabilize protein structure

    • Low concentrations of DMSO (0.5-2%) to aid folding

    • Channel blockers during expression to stabilize conformation

  • Co-expression Strategies:

    • Co-express with partner subunits (KCNB1, KCNB2) for functional assembly

    • Include chaperone proteins (BiP, calnexin, HSP70 family)

    • Add PDI or other disulfide isomerases for proper disulfide formation

4. Purification and Validation:

  • Membrane Extraction:

    • Screen detergents systematically (DDM, LMNG, GDN) for optimal extraction

    • Consider amphipol or nanodisc reconstitution for stability

  • Chromatography Strategy:

    • Initial IMAC purification via histidine tag

    • Size exclusion chromatography to remove aggregates

    • Ion exchange as polishing step

  • Functional Validation:

    • Co-purification with partner subunits to verify complex formation

    • Reconstitution into liposomes for functional assays

    • Verification of modulatory effects on partner channels

For storage of purified recombinant KCNV1, use a Tris-based buffer with 50% glycerol at -20°C or -80°C to maintain long-term stability . Implement quality control at each production stage, using Western blotting with specific antibodies (1:2000-1:10000 dilution) to track expression and purification efficiency.

What are the critical controls needed when studying the electrophysiological effects of KCNV1 on partner channels?

When investigating the electrophysiological effects of KCNV1 on partner channels, implementing rigorous controls is essential to ensure data validity and interpretability. Given KCNV1's role as a modulatory subunit that cannot form functional channels independently , the following comprehensive control framework is recommended:

1. Expression System Controls:

  • Partner Channel Expression Verification:

    • Quantitative Western blotting to confirm consistent expression levels between experimental conditions

    • Surface biotinylation to verify membrane localization

    • Fluorescent tagging to visualize trafficking patterns

  • KCNV1 Expression Verification:

    • Antibody-based detection using verified KCNV1 antibodies (e.g., catalog number 85153-3-RR)

    • Titration of expression levels to establish dose-response relationship

    • Inducible expression systems to enable within-cell controls

  • Co-expression Controls:

    • Bicistronic constructs to ensure co-expression in the same cells

    • FRET-based approaches to confirm proximity/interaction

    • Single-cell PCR from recorded cells to verify co-expression

2. Electrophysiological Recording Controls:

  • Voltage Protocol Controls:

    • Standardized holding potentials (-80mV recommended)

    • Consistent interpulse intervals to control for use-dependent effects

    • Temperature control (room temperature vs. physiological)

  • Perfusion System Controls:

    • Vehicle controls for all solutions

    • Flow rate standardization

    • Solution exchange time verification

  • Recording Quality Controls:

    • Series resistance monitoring throughout experiments (<15MΩ ideal, <20% change)

    • Capacitance compensation standardization

    • Leak subtraction consistency (P/4 or P/8 protocols)

3. Specificity Controls:

Control TypeImplementationPurpose
Dominant-negative KCNV1Expression of pore-mutated KCNV1Confirm specificity of modulatory effects
Heterologous subunitsCo-expression with non-target channels (KCNA family)Verify specificity of interaction
Chimeric constructsKCNV1/KCNQ chimeras focusing on C-terminus regionsIdentify domains responsible for modulation
Competing peptidesIntracellular application of C-terminal peptidesDisrupt specific interactions

4. Pharmacological Controls:

  • Selective Blockers:

    • Application of channel-specific blockers (e.g., guangxitoxin for KCNB channels)

    • Differential sensitivity with/without KCNV1 co-expression

    • Dose-response curves to detect shifts in pharmacological sensitivity

  • Channel Modifiers:

    • Application of N-ethylmaleimide (NEM) which affects related channels

    • Testing whether KCNV1 alters responses to chemical modifiers

    • Cysteine-modifying reagents to probe accessible residues

5. Data Analysis Controls:

  • Blinded Analysis:

    • Blinded scoring of key parameters (activation threshold, inactivation rate)

    • Automated analysis algorithms applied consistently across conditions

    • Independent verification of effects by multiple investigators

  • Statistical Approaches:

    • Paired recordings where possible (before/after expression)

    • Power analysis to determine appropriate sample sizes

    • Multiple statistical tests to confirm significance of effects

When reporting results, researchers should clearly document all control experiments performed and provide raw data traces alongside analyzed parameters to enable proper evaluation of KCNV1's modulatory effects.

How can researchers accurately quantify the expression and membrane localization of KCNV1 in experimental systems?

Accurately quantifying the expression and membrane localization of KCNV1 in experimental systems requires a multi-technique approach that addresses the challenges associated with membrane protein analysis. The following methodological framework provides comprehensive strategies for KCNV1 quantification:

1. Immunological Detection Methods:

  • Western Blot Quantification:

    • Use validated antibodies specific to KCNV1 at optimal dilutions (1:2000-1:10000)

    • Include recombinant protein standards for absolute quantification

    • Employ appropriate positive controls (mouse brain tissue, U-87 MG cells, rat brain tissue)

    • Use infrared fluorescence-based detection for wider linear range and better quantification

  • Flow Cytometry:

    • Non-permeabilized cells to detect surface expression

    • Permeabilized cells for total protein quantification

    • Multi-parameter analysis to correlate with cell cycle or stress markers

2. Surface-Specific Quantification Techniques:

  • Surface Biotinylation:

    • Cell-impermeable NHS-SS-biotin labeling of surface proteins

    • Streptavidin pull-down followed by KCNV1 immunoblotting

    • Comparison of surface vs. total expression

  • Cell Surface ELISA:

    • Fixed, non-permeabilized cells probed with KCNV1 antibodies

    • Colorimetric or chemiluminescent detection

    • High-throughput compatible for screening experiments

3. Advanced Imaging Approaches:

TechniqueApplicationQuantification MethodResolution
Confocal MicroscopySubcellular localizationColocalization with membrane markers (Pearson's coefficient)~200 nm
TIRF MicroscopyPlasma membrane expressionFluorescence intensity within evanescent fieldSelective for membrane (~100 nm)
Super-resolution (STORM/PALM)Nanoscale organizationSingle-molecule counting and cluster analysis10-20 nm
FRAPLateral mobility in membraneRecovery half-time and mobile fractionDiffusion dynamics

4. Biochemical Fractionation Methods:

  • Density Gradient Fractionation:

    • Separation of cellular compartments by ultracentrifugation

    • Immunoblotting of fractions for KCNV1

    • Co-localization with compartment markers (Na⁺/K⁺-ATPase for plasma membrane)

  • Detergent Resistance Fractionation:

    • Analysis of KCNV1 distribution in membrane microdomains

    • Correlation with lipid raft markers

    • Impact of heteromeric assembly on microdomain localization

5. Electrophysiological Estimation:

  • Noise Analysis:

    • Non-stationary noise analysis of macroscopic currents

    • Estimation of functional channel density at membrane

    • Correlation with biochemical quantification

  • Limiting Dilution Approach:

    • Titration of KCNV1 cDNA in co-expression systems

    • Identification of functional threshold for partner channel modulation

    • Estimation of stoichiometry requirements

6. Mass Spectrometry-Based Absolute Quantification:

  • Selected Reaction Monitoring (SRM):

    • Identification of KCNV1-specific peptides

    • Isotope-labeled internal standards for absolute quantification

    • Membrane preparation optimization for maximum recovery

When implementing these techniques, researchers should consider that KCNV1 cannot form functional channels by itself , so functional expression must be verified through its modulatory effects on partner channels. The correlation between protein expression levels and functional modulation provides critical insights into the stoichiometry and efficiency of heteromeric channel assembly.

What are the best approaches for generating and validating KCNV1 antibodies for research applications?

Generating and validating high-quality antibodies against KCNV1 is critical for advancing research on this important modulatory potassium channel subunit. The following comprehensive framework outlines best practices for developing and rigorously validating KCNV1-specific antibodies:

1. Strategic Antigen Design:

  • Epitope Selection Considerations:

    • Target unique regions not conserved in other potassium channel subunits

    • Focus on extracellular domains for surface labeling applications

    • Select C-terminal regions for subunit-specific detection

    • Avoid transmembrane domains due to poor immunogenicity and accessibility

  • Antigen Formats:

    • Synthetic peptides (15-25 amino acids) conjugated to carrier proteins

    • Recombinant protein fragments (50-150 amino acids)

    • Full-length recombinant protein in detergent micelles or nanodiscs

    • DNA immunization with KCNV1-encoding vectors

2. Antibody Generation Platforms:

PlatformAdvantagesLimitationsOptimal Applications
Polyclonal (rabbit)Multiple epitopes; robust signalBatch variation; limited quantityWestern blot; immunoprecipitation
Monoclonal (mouse/rat)Consistent specificity; renewableSingle epitope; may lack cross-reactivityAll applications; especially imaging
Recombinant antibodiesDefined sequence; renewableHigher development costReproducible research; therapeutic applications
Nanobodies (VHH)Small size; access to confined epitopesLower affinity; specialized productionSuper-resolution imaging; intrabodies

3. Rigorous Validation Strategies:

  • Genetic Controls:

    • Testing in KCNV1 knockout tissues/cells (negative control)

    • Testing in KCNV1 overexpression systems (positive control)

    • Validation across multiple species when cross-reactivity is required

    • siRNA/shRNA knockdown for partial reduction controls

  • Biochemical Validation:

    • Western blot showing expected molecular weight (~56 kDa)

    • Pre-adsorption with immunizing antigen to confirm specificity

    • Cross-reactivity testing against related potassium channels

    • Detection of native vs. denatured protein (conformation-specific epitopes)

  • Immunostaining Validation:

    • Co-localization with orthogonal KCNV1 detection methods

    • Comparison with mRNA expression pattern (RNAscope/ISH)

    • Subcellular localization consistent with known biology

    • Competition experiments with excess antigen

4. Application-Specific Validation:

  • For Western Blotting:

    • Optimal concentration determination (1:2000-1:10000 for catalog number 85153-3-RR)

    • Blocking condition optimization

    • Detection method comparison (chemiluminescence vs. fluorescence)

    • Sample preparation effects (reducing vs. non-reducing conditions)

  • For Immunoprecipitation:

    • Pull-down efficiency quantification

    • Co-IP of known interaction partners (KCNB1, KCNB2)

    • Mass spectrometry verification of precipitated proteins

    • Detergent compatibility testing

  • For Immunohistochemistry/Immunocytochemistry:

    • Fixation method optimization (paraformaldehyde vs. methanol)

    • Antigen retrieval requirement determination

    • Signal-to-noise optimization

    • Specificity in complex tissues (brain regions with known expression)

5. Documentation and Reporting Standards:

  • Critical Information to Report:

    • Complete epitope sequence and position within KCNV1

    • Host species and antibody isotype

    • Validation experiments performed with positive and negative controls

    • Specific conditions for each application (dilution, incubation time, temperature)

    • Known limitations or cross-reactivity

When selecting commercial antibodies like catalog number 85153-3-RR , researchers should review the validation data provided by manufacturers and conduct independent validation in their specific experimental systems. For reproducibility, detailed reporting of antibody catalog numbers, lots, and validation results is essential in scientific publications.

How should researchers analyze and interpret changes in channel kinetics when studying KCNV1 modulation of partner channels?

Analyzing and interpreting changes in channel kinetics when studying KCNV1 modulation of partner channels requires sophisticated approaches that account for the complex biophysical parameters of ion channel function. Given that KCNV1 modulates KCNB1 and KCNB2 by shifting inactivation thresholds and slowing inactivation rates , the following analytical framework ensures rigorous quantification and interpretation:

1. Activation Kinetics Analysis:

  • Voltage-Dependence of Activation:

    • Fit conductance-voltage (G-V) relationships with Boltzmann functions:
      G/Gmax=1/(1+exp((V1/2V)/k))G/G_{max} = 1/(1+\exp((V_{1/2}-V)/k))

    • Compare V₁/₂ (half-activation voltage) and k (slope factor) between control and KCNV1 co-expression

    • Analyze leftward/rightward shifts in activation curves

  • Activation Rate Quantification:

    • Fit rising phase of currents with exponential functions:
      I(t)=Imax(1exp(t/τact))I(t) = I_{max}(1-\exp(-t/\tau_{act}))

    • Compare activation time constants (τ_act) across voltage range

    • Generate plots of τ_act vs. voltage to identify voltage-dependent effects

2. Inactivation Kinetics Analysis:

  • Steady-State Inactivation:

    • Implement dual-pulse protocols and fit with Boltzmann function:
      I/Imax=1/(1+exp((VV1/2)/k))I/I_{max} = 1/(1+\exp((V-V_{1/2})/k))

    • Quantify negative shift in V₁/₂ expected with KCNV1 modulation

    • Analyze changes in slope factor which may indicate altered coupling energetics

  • Inactivation Rate Analysis:

    • Fit current decay with appropriate function (single/double exponential):
      I(t)=Aexp(t/τfast)+Bexp(t/τslow)+CI(t) = A\exp(-t/\tau_{fast}) + B\exp(-t/\tau_{slow}) + C

    • Calculate weighted time constants if multiple components exist

    • Generate plots of τ_inact vs. voltage to characterize voltage-dependence

3. Recovery from Inactivation:

ParameterAnalysis MethodExpected KCNV1 EffectPhysiological Significance
Recovery time courseTwo-pulse protocol with varying intervalsProlonged recovery phaseInfluences channel availability during repetitive activity
Recovery time constantFit with exponential functionIncreased time constantAffects channel refractory period
Fractional recoveryCompare recovery at fixed intervalsReduced fractional recoveryImpacts frequency-dependent channel activity

4. Advanced Kinetic Modeling:

  • Markov State Modeling:

    • Develop multi-state models incorporating closed, open, and inactivated states

    • Fit rate constants with and without KCNV1 co-expression

    • Identify which transitions are most affected by KCNV1

  • Energy Landscape Analysis:

    • Calculate free energy differences between states

    • Quantify how KCNV1 alters energy barriers between states

    • Correlate with structural elements in the C-terminus identified as important for modulation

5. Physiological Consequence Interpretation:

  • Action Potential Modeling:

    • Incorporate measured kinetic parameters into neuronal models

    • Simulate impact on action potential waveform and firing patterns

    • Predict pathophysiological consequences of KCNV1 variants

  • Frequency Response Analysis:

    • Apply repetitive stimulation protocols at various frequencies

    • Quantify use-dependent inactivation characteristics

    • Determine how KCNV1 modulation affects frequency filtering properties

When interpreting kinetic changes, researchers should consider that KCNV1 effects may be concentration-dependent and might exhibit different magnitudes depending on the specific partner channel (KCNB1 vs. KCNB2) . Statistical analysis should include both parametric comparisons of kinetic parameters and non-parametric comparisons of raw current traces to capture complex changes in channel behavior that may not be fully described by simplified models.

What statistical approaches are most appropriate for analyzing KCNV1 experimental data?

1. Experimental Design Considerations:

  • Power Analysis:

    • Conduct a priori power analysis based on expected effect sizes

    • For electrophysiology: typically n=8-15 cells per condition from ≥3 independent transfections

    • For biochemical assays: n=3-5 independent experiments with technical replicates

  • Randomization and Blinding:

    • Randomize order of recording/analysis conditions

    • Implement blinded analysis for subjective measurements

    • Use automated analysis pipelines to reduce bias

  • Control for Variability Sources:

    • Account for day-to-day variability with paired designs

    • Control for expression level variability with internal controls

    • Consider cell passage number and transfection efficiency as covariates

2. Appropriate Statistical Tests by Data Type:

Data TypeRecommended TestsAssumptionsAlternative Non-parametric Tests
Continuous parameters (V₁/₂, τ)Paired/unpaired t-test; ANOVA with post-hoc testsNormality; equal varianceMann-Whitney U; Kruskal-Wallis
Dose-response relationshipsNonlinear regression; EC₅₀/IC₅₀ comparisonAppropriate model selectionBootstrap confidence intervals
Current-voltage relationshipsRepeated measures ANOVA; AUC analysisSphericity; normalityFriedman test with Dunn's post-hoc
Categorical outcomesChi-square; Fisher's exact testExpected frequencies >5N/A
Time series dataMixed-effects models; frequency domain analysisIndependent residualsPermutation-based approaches

3. Advanced Analytical Approaches:

  • Multivariate Analysis:

    • Principal Component Analysis (PCA) to identify major sources of variation

    • Cluster analysis to identify channel subpopulations

    • MANOVA when multiple dependent variables are interrelated

  • Bayesian Statistical Approaches:

    • Markov Chain Monte Carlo (MCMC) for complex model fitting

    • Hierarchical Bayesian models to account for cell-to-cell variability

    • Calculation of Bayes factors for hypothesis testing

  • Machine Learning Techniques:

    • Support Vector Machines for classification of channel states

    • Random Forest approaches for identifying important modulatory features

    • Dimensionality reduction for visualizing complex electrophysiological datasets

4. Specific Considerations for KCNV1 Studies:

  • Dealing with Heterogeneity:

    • Single-channel analysis: mixture modeling to identify subconductance states

    • Whole-cell analysis: account for variable KCNV1:partner subunit ratios

    • Population studies: consider genetic background as covariate

  • Multiple Comparison Correction:

    • Bonferroni correction for limited planned comparisons

    • False Discovery Rate (FDR) control for larger parameter sets

    • Tukey or Dunnett post-hoc tests for ANOVA depending on comparison interest

  • Regression Analysis for Structure-Function Studies:

    • Multiple regression to correlate structural features with functional outcomes

    • Hierarchical regression to test specific mechanistic hypotheses

    • Nonlinear regression for complex biophysical relationships

5. Reporting Standards:

When analyzing KCNV1 modulatory effects on partner channels, researchers should focus on both the statistical significance of observed changes and their biophysical/physiological relevance. Given that KCNV1 produces specific effects on inactivation threshold and kinetics , statistical approaches should be tailored to detect these particular parameters with high sensitivity.

What are the most promising future directions for KCNV1 research in primates?

The study of KCNV1 in primates represents a fertile ground for future research with significant implications for understanding neurological function and developing novel therapeutic approaches. Building on current knowledge of KCNV1's role as a modulatory potassium channel subunit that regulates neuronal excitability , several promising research directions emerge:

1. Advanced Structural Biology Approaches:

The determination of high-resolution structures of heteromeric KCNV1-containing channels would significantly advance our understanding of how this modulatory subunit influences channel gating and pharmacology. Cryo-electron microscopy of KCNV1/KCNB complexes could reveal the molecular interfaces and conformational changes underlying the observed electrophysiological effects, particularly the mechanisms responsible for shifting inactivation thresholds to more negative values and slowing inactivation rates .

2. Comprehensive Brain Expression Mapping:

Detailed comparative analysis of KCNV1 expression patterns across primate species could reveal evolutionary adaptations in neuronal excitability regulation. Using techniques like single-cell transcriptomics and spatial transcriptomics in Macaca fascicularis and human brain samples would identify cell type-specific expression patterns and potential species differences that might contribute to primate-specific neurological capabilities or vulnerabilities to disorders.

3. Genetic Association Studies:

Expanding on preliminary associations between KCNV1 variants and neurological conditions like schizophrenia , comprehensive genetic studies across primate populations could identify functional variants with physiological consequences. This approach could be particularly powerful if combined with electrophysiological characterization of identified variants to establish clear genotype-phenotype relationships.

4. Translational Neuroscience Applications:

Development of selective modulators of KCNV1-containing channels represents a promising approach for treating neurological disorders characterized by altered neuronal excitability. The unique tissue-specific expression pattern makes KCNV1-containing channels potentially desirable pharmacological targets . Primate models would be invaluable for evaluating the efficacy and safety of such compounds before human clinical trials.

5. Comparative Electrophysiology:

Detailed comparative analysis of how KCNV1 modulates channel properties across primate species could reveal subtle evolutionary adaptations in neuronal signaling. This research direction could explore whether differences in KCNV1 sequence or expression between Macaca fascicularis and humans contribute to species-specific neuronal excitability characteristics.

6. Systems Neuroscience Integration:

Understanding how KCNV1-mediated modulation of channel properties affects circuit-level function represents an important frontier. Using techniques like optogenetics and chemogenetics in combination with electrophysiological recordings in primate brain slices or in vivo models could reveal how KCNV1-containing channels contribute to network dynamics and information processing.

7. Therapeutic Applications:

Given KCNV1's role in modulating neuronal excitability , development of gene therapy approaches to correct pathological alterations in KCNV1 expression or function represents a promising therapeutic direction. Evaluating such approaches in primate models would provide crucial translational insights before human applications.

These future directions highlight the multifaceted potential of KCNV1 research in primates, spanning from molecular mechanisms to therapeutic applications. The unique characteristics of KCNV1 as a modulatory subunit with tissue-specific expression and distinctive effects on channel kinetics make it a fascinating subject for continued scientific exploration with significant implications for understanding and treating neurological disorders.

How might KCNV1 research contribute to understanding and treating neurological disorders?

KCNV1 research holds significant potential for advancing our understanding and treatment of neurological disorders through multiple mechanistic and translational pathways. As a modulatory potassium channel subunit with brain-specific expression that regulates neuronal excitability , KCNV1 intersects with fundamental pathophysiological processes underlying numerous neurological conditions:

1. Pathophysiological Insights for Psychiatric Disorders:

The reported association between KCNV1 variants and schizophrenia suggests an important role for this channel in psychiatric illness. KCNV1's ability to modulate KCNB channels by shifting inactivation thresholds and slowing inactivation rates could directly affect neuronal firing patterns in prefrontal cortex and limbic regions critical for cognitive and emotional processing. This modulatory function could represent a convergence point for multiple genetic risk factors that ultimately manifest as altered circuit function.

Research focused on characterizing how disease-associated KCNV1 variants affect channel function could reveal electrophysiological endophenotypes of psychiatric disorders and potentially identify novel therapeutic targets. By altering the available pool of repolarizing potassium channels, KCNV1 dysfunction might contribute to the excitation-inhibition imbalance hypothesized to underlie conditions like schizophrenia, bipolar disorder, and autism spectrum disorders.

2. Epilepsy Mechanisms and Therapeutics:

Given KCNV1's role in regulating neuronal excitability , its dysfunction could contribute to the hyperexcitability characterizing epileptic disorders. By modulating KCNB channels, which play critical roles in action potential repolarization and firing frequency adaptation, KCNV1 could serve as a regulatory checkpoint preventing excessive neuronal firing.

Potential therapeutic applications include:

  • Development of compounds that enhance KCNV1 modulatory effects to reduce neuronal hyperexcitability

  • Gene therapy approaches to normalize KCNV1 expression in epileptic foci

  • Identification of patients with KCNV1 variants who might benefit from personalized treatment approaches

3. Neurodegenerative Disease Mechanisms:

Emerging evidence suggests links between dysregulated neuronal excitability and neurodegenerative processes. As a modulator of neuronal firing properties, KCNV1 could influence calcium homeostasis, metabolic stress, and excitotoxicity—all implicated in neurodegeneration. Research examining KCNV1 expression and function in aging and neurodegenerative conditions could reveal whether changes in this modulatory subunit contribute to disease progression.

4. Precision Medicine Approaches:

Disorder CategoryKCNV1 Research ApplicationPotential Impact
ChannelopathiesIdentification of KCNV1 variants with functional consequencesGenetic diagnosis and targeted therapies
Epilepsy syndromesCharacterization of KCNV1 contributions to seizure susceptibilityNovel antiepileptic drug targets
Psychiatric disordersAnalysis of KCNV1 variants in patient populationsStratification of patient subgroups for treatment selection
Pain disordersInvestigation of KCNV1 in sensory neuron excitabilityNew analgesic development

5. Novel Therapeutic Strategies:

KCNV1 research could lead to several innovative therapeutic approaches:

  • Subunit-Specific Channel Modulators:
    Development of compounds that specifically affect heteromeric channels containing KCNV1, potentially offering greater specificity than current ion channel drugs

  • Gene Therapy Approaches:
    Viral vector-delivered KCNV1 could normalize function in conditions characterized by reduced expression or function

  • RNA-Based Therapeutics:
    Antisense oligonucleotides or siRNAs targeting KCNV1 could provide temporary modulation of channel function in conditions involving KCNV1 overactivity

  • Allosteric Modulators:
    Compounds that bind to the KCNV1-KCNB interface could selectively modify the modulatory effects without blocking channel function

6. Biomarker Development:

KCNV1 research could facilitate the development of biomarkers for neurological disorders:

  • Electrophysiological signatures associated with specific KCNV1 variants

  • Neuroimaging correlates of altered KCNV1 function

  • Cerebrospinal fluid proteomic signatures associated with KCNV1 dysfunction

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.