Recombinant Macaca fascicularis PRA1 family protein 3 (ARL6IP5)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics

ARL6IP5, also termed PRA1 family protein 3, is encoded by the ARL6IP5 gene. It belongs to the prenylated Rab acceptor (PRA1) family, which is involved in vesicular trafficking and membrane protein interactions . Key features include:

PropertyDetails
Gene NameARL6IP5
SynonymsPRAF3, Aip-5, GTRAP3-18, DERP11
Protein Length188 amino acids (Full-length)
Post-Translational RoleBinds glutamate transporter EAAC1 (SLC1A1), modulating its activity .
Key DomainsPredicted transmembrane regions and cytoskeleton-binding motifs .

The recombinant form retains these functional properties and is used to study mechanisms of glutamate transport, oxidative stress responses, and intracellular trafficking.

Key Roles in Cellular Processes

  • Glutamate Transport Regulation: Binds and inhibits the glutamate transporter EAAC1 (SLC1A1), reducing glutamate uptake in a PKC-dependent manner .

  • Neuroprotection: Mouse knockout models show increased neuronal glutathione levels and enhanced resistance to oxidative stress .

  • Vitamin A Responsiveness: Gene expression is upregulated by retinoic acid, linking it to differentiation pathways .

Interaction Partners

ARL6IP5 interacts directly with:

  • SLC1A1 (EAAC1): Modulates glutamate transport kinetics .

  • RNF185 and CCR5: Implicated in membrane trafficking and immune signaling .

Applications in Research

Recombinant ARL6IP5 is utilized in:

  • Mechanistic Studies: Investigating glutamate transport dysregulation in neurological disorders.

  • Drug Discovery: Screening for modulators of EAAC1 or oxidative stress pathways.

  • Structural Biology: Analyzing transmembrane domain interactions via crystallography or NMR.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ARL6IP5; PRAF3; QnpA-10140; PRA1 family protein 3; ADP-ribosylation factor-like protein 6-interacting protein 5; ARL-6-interacting protein 5; Aip-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
ARL6IP5
Target Protein Sequence
MDVNIAPLRAWDDFFPGSDRFAQPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISVVGF LSPFNMILGGIVVVLVFTGFVWAAHNKDALRRLKKRYPTTFVMVVMLASYFLISMFGGVM VFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLT DYISKVKE
Uniprot No.

Target Background

Function
This protein regulates intracellular concentrations of taurine and glutamate. It negatively modulates SLC1A1/EAAC1 glutamate transport activity by decreasing its affinity for glutamate in a PKC activity-dependent manner. This protein plays a role in the retention of SLC1A1/EAAC1 in the endoplasmic reticulum.
Database Links

KEGG: mcf:101925344

UniGene: Mfa.8584

Protein Families
PRA1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasm. Cytoplasm, cytoskeleton.

Q&A

What is ARL6IP5 and what is its primary function in cellular processes?

ADP-ribosylation-like factor 6 interacting protein 5 (ARL6IP5) belongs to the PRAF3 family and has multiple aliases across species, including JWA in humans, Addicsin in mice, and GTRAP 3-18 or JM4 in rats. The protein contains a functionally large prenylated acceptor domain 1, primarily involved in intracellular protein trafficking . ARL6IP5 is an established negative regulator of the EAAC1 transporter and has been identified as a novel regulator of neuronal autophagy .

Recent research has revealed that ARL6IP5 functions as an autophagy inducer by enhancing Rab1-dependent autophagosome initiation and elongation through stabilization of free ATG12 . While previously extensively studied in cancer metastasis, its functions in neurological contexts have become an emerging focus of research, particularly its role in protein aggregate clearance and neuroprotection .

How does ARL6IP5 expression change with age and in neurodegenerative diseases?

Scientific evidence demonstrates that ARL6IP5 levels decrease significantly in the brain with age in both mice and humans. Studies have shown decreases of 24 ± 22% at 8 months and 44 ± 17% at 12 months compared to 4-month-old mice . This age-related decline appears to be exacerbated in neurodegenerative conditions.

In Parkinson's disease models, transgenic mice typically show lower levels of ARL6IP5 compared to wild-type controls across multiple age points . At the cellular level, models of PD using α-synuclein overexpression demonstrate significant reductions in ARL6IP5 levels—58 ± 19% in cells overexpressing wild-type α-synuclein and 60 ± 25% in cells expressing the A53T mutant compared to control cells . These findings strongly suggest that ARL6IP5 downregulation may be a contributing factor to the pathogenesis of neurodegenerative diseases, particularly those associated with α-synuclein aggregation.

What cellular pathways involve ARL6IP5?

ARL6IP5 participates in several critical cellular pathways:

  • Autophagy regulation: ARL6IP5 functions as an autophagy inducer through interaction with ATG12 and enhancement of Rab1-dependent autophagosome initiation and elongation. Overexpression of ARL6IP5 increases autophagy by approximately 150 ± 54% compared to control conditions .

  • Protein trafficking: As a member of the PRAF3 family with a prenylated acceptor domain, ARL6IP5 is involved in intracellular protein transport mechanisms .

  • Protein aggregate clearance: ARL6IP5 promotes the clearance of toxic α-synuclein aggregates through autophagy induction, with studies showing a decrease in the level of A53T-α-synuclein fluorescence with ARL6IP5 expression .

  • Cellular stress response: ARL6IP5 appears to counteract cellular stress conditions induced by protein aggregation, as knockdown of ARL6IP5 in a cellular model of PD shows increased toxicity compared to α-synuclein overexpression alone .

  • Kinase signaling pathways: ARL6IP5 influences the phosphorylation status of key signaling molecules. For instance, ARL6IP5 overexpression can significantly increase the phosphorylation of Mer (321 ± 24% compared to control) .

What experimental approaches are optimal for studying ARL6IP5's role in autophagy?

To effectively investigate ARL6IP5's role in autophagy, researchers should implement a multi-faceted experimental strategy:

  • Genetic manipulation techniques:

    • CRISPR-Cas9 gene editing to generate ARL6IP5 knockout cell lines (as available in HeLa cells)

    • Overexpression systems using lentiviral or plasmid vectors containing Macaca fascicularis ARL6IP5

    • siRNA-mediated knockdown for transient reduction of ARL6IP5 expression

  • Autophagy flux analysis:

    • LC3-II/LC3-I ratio determination via western blotting

    • Use of lysosomal inhibitors (e.g., bafilomycin A1, chloroquine) to distinguish between induction and blocked degradation

  • Protein interaction studies:

    • Co-immunoprecipitation assays to confirm ARL6IP5 interaction with ATG12 and Rab1

    • Proximity ligation assays to visualize protein interactions in situ

  • Functional outcome assessments:

    • α-synuclein aggregation quantification

    • Cell viability and toxicity assays (e.g., LDH release assay) under stress conditions

Published data shows that overexpression of ARL6IP5 increases autophagy (177 ± 45% compared to control), while knockdown inhibits autophagy (45 ± 13% compared to control) . When designing experiments, it's important to include appropriate controls and measure multiple parameters to comprehensively assess ARL6IP5's impact on the autophagy pathway.

How does α-synuclein downregulate ARL6IP5 expression at the molecular level?

The molecular mechanisms through which α-synuclein downregulates ARL6IP5 expression represent a critical area of investigation. Based on current research, several potential pathways may be involved:

  • Transcriptional regulation:

    • α-synuclein may influence transcription factors that regulate ARL6IP5 gene expression

    • Potential involvement of epigenetic modifications such as DNA methylation or histone acetylation

  • Post-transcriptional regulation:

    • α-synuclein might affect ARL6IP5 mRNA stability or processing

    • Potential involvement of microRNAs that target ARL6IP5 mRNA

  • Post-translational regulation:

    • α-synuclein may enhance proteasomal or lysosomal degradation of ARL6IP5 protein

    • Studies using proteasome inhibitors or lysosomal inhibitors can determine if α-synuclein affects ARL6IP5 protein stability

Research has shown that α-synuclein overexpression leads to a 58 ± 19% reduction in ARL6IP5 levels, while the A53T mutant causes a 60 ± 25% reduction . Understanding the exact molecular mechanisms behind this downregulation could reveal novel therapeutic targets for interrupting the pathological cascade in synucleinopathies.

What mechanisms explain ARL6IP5's ability to reduce α-synuclein aggregate burden?

ARL6IP5 has demonstrated the ability to reduce α-synuclein aggregate burden through several interconnected mechanisms:

  • Enhanced autophagy induction:

    • ARL6IP5 overexpression increases autophagy (measured by LC3-II/LC3-I ratio) by approximately 150-177%

    • This enhanced autophagy promotes clearance of protein aggregates

  • ATG12 stabilization pathway:

    • ARL6IP5 interacts with and stabilizes free ATG12, an essential component of the ATG12-ATG5-ATG16L1 complex required for autophagosome formation

    • This stabilization promotes efficient autophagosome formation

  • Rab1-dependent autophagosome initiation:

    • ARL6IP5 enhances Rab1-dependent processes critical for the early stages of autophagosome formation

    • The ARL6IP5/Rab1/ATG12 axis appears to be central for neuroprotection in PD models

  • Restoration of kinase signaling:

    • ARL6IP5 counteracts α-synuclein-induced changes in phosphorylation of key signaling molecules

    • For example, ARL6IP5 overexpression increases Mer phosphorylation (321 ± 24% compared to control), which was reduced by α-synuclein overexpression

Experimental evidence shows that ARL6IP5 expression in cells stably expressing mutant GFP-A53T α-synuclein results in a significant decrease in α-synuclein fluorescence (from 58 ± 24 in control cells to 28 ± 33 in ARL6IP5 transfected cells, p < 0.0001) .

How can ARL6IP5-based therapeutic approaches be developed for neurodegenerative diseases?

Development of ARL6IP5-based therapeutics for neurodegenerative diseases can proceed through several strategic approaches:

  • Gene therapy approaches:

    • Viral vector-mediated delivery of ARL6IP5 to affected brain regions

    • Development of neuron-specific promoters for targeted expression

    • CRISPR activation systems to enhance endogenous ARL6IP5 expression

  • Small molecule development:

    • High-throughput screening for compounds that increase ARL6IP5 expression

    • Structure-based drug design targeting ARL6IP5 functional domains

    • Repurposing of approved drugs that may modulate ARL6IP5 pathways

  • Combination therapies:

    • Pairing ARL6IP5-enhancing compounds with other autophagy modulators

    • Co-administration with compounds that reduce α-synuclein production

  • Biomarker development for patient stratification:

    • Identification of patients with reduced ARL6IP5 levels who may benefit most from therapy

    • Development of companion diagnostics for ARL6IP5-targeted treatments

Experimental evidence supports the therapeutic potential of ARL6IP5, as overexpression reduces α-synuclein burden and improves cell survival in PD models . Specifically, siRNA-mediated knockdown of ARL6IP5 in a cellular model of PD confirms its role in neuroprotection, as it shows increased toxicity (15 ± 7%, p = 0.018) compared to α-synuclein overexpression alone .

What are the optimal conditions for expressing and purifying recombinant Macaca fascicularis ARL6IP5?

The expression and purification of recombinant Macaca fascicularis ARL6IP5 require careful optimization due to its membrane-associated nature. The following protocol outlines optimal conditions:

Expression System Selection:

Expression SystemAdvantagesConsiderationsYield Optimization
E. coli (BL21-DE3)Cost-effective, rapidMay lack post-translational modificationsUse lower induction temperature (16-18°C)
Insect cells (Sf9/Hi5)Better folding, some PTMsHigher cost, longer processOptimize MOI (1-5), harvest at 48-72 hours
Mammalian cells (HEK293)Native-like PTMs and foldingHighest cost, complex mediaStable cell lines for consistent yields

Optimization Steps:

  • Vector design considerations:

    • Include a cleavable affinity tag (His6, GST, or FLAG)

    • Consider fusion to solubility enhancers (MBP, SUMO) for improved solubility

    • Codon optimization for the expression host

  • Solubilization and extraction:

    • Use mild detergents like DDM (n-Dodecyl β-D-maltoside) or LMNG

    • Include protease inhibitors (PMSF, EDTA, leupeptin, aprotinin)

    • Perform extraction at 4°C to minimize degradation

  • Purification strategy:

    • IMAC (Immobilized Metal Affinity Chromatography) for His-tagged constructs

    • Follow with size exclusion chromatography to remove aggregates

    • Maintain detergent above CMC throughout purification

  • Quality control assessments:

    • SDS-PAGE and western blotting for purity and identity confirmation

    • Circular dichroism to verify secondary structure

    • Functional assays to confirm activity (e.g., ATG12 binding assay)

The ARL6IP5 Knockout cell line available in HeLa cells can serve as a negative control for validating the specificity of purified recombinant protein in functional assays.

How can ARL6IP5 knockout models be generated and validated?

Generating and validating ARL6IP5 knockout models requires systematic approaches to ensure complete ablation of protein function:

Generation of ARL6IP5 Knockout Models:

  • CRISPR-Cas9 genome editing:

    • Design multiple sgRNAs targeting conserved exons (preferably early exons)

    • Employ dual sgRNA approach to create large deletions for complete knockout

    • Optimize delivery method according to the model system (transfection, electroporation)

  • Model system considerations:

    • Cellular models: HeLa cells (as referenced in search result) , neuronal cell lines like SH-SY5Y

    • Animal models: mice, zebrafish for systemic studies

    • iPSC-derived neurons for humanized models

Validation Methods for ARL6IP5 Knockout:

  • Genomic validation:

    • PCR amplification and sequencing of the targeted region

    • TIDE (Tracking of Indels by Decomposition) analysis for quantifying editing efficiency

  • Transcript validation:

    • RT-PCR to verify altered mRNA expression

    • qRT-PCR for quantitative assessment of transcript levels

  • Protein validation:

    • Western blotting using antibodies against different epitopes of ARL6IP5

    • Immunofluorescence microscopy to confirm absence of protein

  • Functional validation:

    • Autophagy flux assays (LC3-II/LC3-I ratio analysis)

    • Measure susceptibility to α-synuclein aggregation (research shows 45 ± 13% inhibition of autophagy with ARL6IP5 knockdown)

    • Assess cell survival under stress conditions (LDH assays show 15 ± 7% increased toxicity with α-synuclein in ARL6IP5 knockdown cells)

    • Rescue experiments with recombinant ARL6IP5 to confirm specificity of phenotypes

  • Off-target analysis:

    • Whole-genome sequencing to identify potential off-target mutations

    • Analysis of top predicted off-target sites

The ARL6IP5 Knockout cell line (HeLa) is commercially available for research applications in virology, immunology, and gene function studies , providing a validated model for investigating ARL6IP5's role in cellular processes.

What assays are recommended for measuring ARL6IP5-mediated autophagy induction?

Given ARL6IP5's role as an autophagy inducer, multiple complementary assays are recommended to comprehensively assess its impact on autophagy:

1. Autophagic flux measurements:

  • LC3 conversion assay: Western blot analysis of LC3-II/LC3-I ratio with and without lysosomal inhibitors

    • Based on research data, expect 150-177% increase in LC3-II/LC3-I ratio with ARL6IP5 overexpression

    • Include conditions with/without lysosomal inhibitors to distinguish between induction and blocked degradation

  • Tandem fluorescent-tagged LC3 assay: Using mRFP-GFP-LC3 to distinguish autophagosomes from autolysosomes

    • Quantify red-only puncta as indicators of successful autophagosome-lysosome fusion

2. Molecular pathway analysis:

  • ATG12-ARL6IP5 interaction assays: Co-immunoprecipitation or proximity ligation assays

    • Quantify interaction under basal and stress conditions

  • Rab1 activation analysis: Measure GTP-bound (active) Rab1

    • Assess how ARL6IP5 manipulation affects Rab1 activation state

  • Phosphorylation status: Immunoblotting with phospho-specific antibodies

    • Monitor kinases influenced by ARL6IP5 (phosphorylation of Mer increased 321 ± 24% with ARL6IP5 overexpression)

3. Functional outcome assays:

  • Protein aggregate clearance: Quantification of α-synuclein aggregates

    • Measure fluorescence reduction in A53T α-synuclein models (from 58 ± 24 in control cells to 28 ± 33 in ARL6IP5-transfected cells)

  • Cell viability under proteotoxic stress: MTT, LDH, or ATP-based assays

    • Challenge cells with proteasome inhibitors or oxidative stressors

  • Selective autophagy markers: Immunostaining for SQSTM1/p62

    • Monitor clearance of these adaptor proteins as indicators of selective autophagy

Experimental evidence confirms that when α-synuclein is overexpressed, it inhibits autophagy (45 ± 13% compared to control), while ARL6IP5 knockdown also inhibits autophagy (45 ± 13%) . The combined effect shows synergistic inhibition (51 ± 23%), demonstrating the importance of using multiple assays to fully characterize ARL6IP5's impact on autophagy.

What are the considerations when designing experiments to study ARL6IP5 in primate versus rodent models?

When designing comparative experiments to study ARL6IP5 across primate (specifically Macaca fascicularis) and rodent models, several important considerations must be addressed:

1. Evolutionary and structural differences:

ConsiderationPrimate ModelsRodent ModelsExperimental Implications
NomenclatureARL6IP5Addicsin (mice), GTRAP 3-18/JM4 (rats) Use consistent terminology in publications
FunctionSimilar autophagy regulationSimilar but may have species-specific aspectsTarget conserved pathways for comparisons
Research applicationsBetter translational relevanceEstablished genetic modelsBalance translational value with practical considerations

2. Experimental design considerations:

  • Antibody selection and validation:

    • Verify epitope conservation across species

    • Validate antibodies specifically in each species studied

    • Use multiple antibodies targeting different protein domains

  • Gene manipulation approaches:

    • Adjust CRISPR guide RNA design for species-specific sequences

    • Account for potential differences in promoter regions for overexpression studies

  • Autophagic pathway assessment:

    • Establish species-specific baseline autophagy rates

    • Compare relative changes rather than absolute values across species

3. Disease modeling considerations:

  • Parkinson's disease models:

    • Primates: MPTP-based models more accurately recapitulate human symptoms

    • Rodents: Wider variety of genetic models available (α-synuclein overexpression, A53T)

    • Consider differences in dopaminergic neuron vulnerability between species

  • Aging-related changes:

    • Account for species-specific aging rates when comparing ARL6IP5 decline

    • In mice, ARL6IP5 decreases 44 ± 17% by 12 months of age

    • Adjust timepoints accordingly for Macaca fascicularis studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.