Recombinant Macaca fascicularis Probable palmitoyltransferase ZDHHC16 (ZDHHC16)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Macaca fascicularis Probable Palmitoyltransferase ZDHHC16

Recombinant Macaca fascicularis Probable Palmitoyltransferase ZDHHC16, also known as ZDHHC16, is a recombinant protein derived from the Macaca fascicularis species. This protein is part of the DHHC family of palmitoyltransferases, which are enzymes responsible for the post-translational modification of proteins through the addition of palmitate groups. This process, known as S-palmitoylation, plays a crucial role in protein function, localization, and stability by altering their hydrophobicity and interactions with membranes .

Characteristics of Recombinant ZDHHC16

The recombinant ZDHHC16 protein is expressed in E. coli and is available as a full-length protein (1-377 amino acids) with an N-terminal His tag. This tag facilitates purification and detection of the protein. The protein is provided in a lyophilized powder form and has a purity of greater than 90% as determined by SDS-PAGE .

Function and Role of ZDHHC16

ZDHHC16 is involved in the palmitoylation of other proteins, which is essential for various cellular processes. In mice, ZDHHC16 is crucial for embryonic and postnatal survival, as well as for eye and heart development . It acts as an upstream palmitoyltransferase in palmitoylation cascades, regulating the activity of downstream palmitoyltransferases like ZDHHC6 .

Research Findings

Research on ZDHHC16 has highlighted its role in regulating the palmitoylation of ZDHHC6, which modifies proteins in the endoplasmic reticulum. The palmitoylation of ZDHHC6 by ZDHHC16 affects its localization, stability, and function, demonstrating the importance of palmitoylation cascades in cellular regulation .

Palmitoylation Dynamics:

  • Palmitoylation Sites: ZDHHC6 can be palmitoylated at three different sites, leading to eight possible palmitoylated species.

  • Interconversion: These species rapidly interconvert through the actions of ZDHHC16 and the Acyl Protein Thioesterase APT2.

  • Regulation: The presence of three palmitoylation sites allows for robust control of ZDHHC6 activity in response to changes in ZDHHC16 activity .

Applications and Future Directions

Recombinant ZDHHC16 proteins are valuable tools for studying the mechanisms of palmitoylation and its role in cellular processes. They can be used in biochemical assays to investigate the dynamics of palmitoylation cascades and their impact on protein function. Further research may uncover additional roles of ZDHHC16 in development and disease, potentially leading to new therapeutic targets.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its incorporation.
Synonyms
ZDHHC16; QtsA-15522; Palmitoyltransferase ZDHHC16; Zinc finger DHHC domain-containing protein 16; DHHC-16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-377
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
ZDHHC16
Target Protein Sequence
MRGQRSLLLGPARLCLRLLLLLGYRRRCPPLLRGLVQRWRYGKVCLRSLLYNSFGGSDTA VDAAFEPVYWLVDNVIRWFGVVFVVLVIVLTGSIVAIAYLCVLPLILRTYSVPRLCWHFF YSHWNLILIVFHYYQAITTPPGYPPQGRNDIATVSICKKCIYPKPARTHHCSICNRCVLK MDHHCPWLNNCVGHYNHRYFFSFCFFMTLGCVYCSYGSWDLFREAYAAIEKMKQLDKNKL QAVANQTYHQTPPPIFSFRERMTHKSLVYLWFLCSSVALALGALTVWHAVLISRGETSIE RHINKKERRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTGRHWLTRVLLPSSHLPHGNGMS WEPPPWVTAHSASVMAV
Uniprot No.

Target Background

Function
ZDHHC16 is a palmitoyl acyltransferase mediating the palmitoylation of proteins such as PLN and ZDHHC6. It plays a crucial role in embryonic heart development and cardiac function, potentially by mediating PLN palmitoylation, influencing PLN phosphorylation and homooligomerization. Furthermore, ZDHHC16 is essential for eye development. Its palmitoylation of ZDHHC6 affects ZDHHC6 quaternary assembly, localization, stability, and function. ZDHHC16 may also participate in DNA damage response, apoptosis regulation, and neural stem cell proliferation via modulation of the FGF/ERK pathway.
Database Links

KEGG: mcf:101926118

UniGene: Mfa.4098

Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is ZDHHC16 and what are its key structural characteristics in Macaca fascicularis?

ZDHHC16 (Zinc finger DHHC domain-containing protein 16) is a probable palmitoyltransferase enzyme that catalyzes the addition of palmitate groups to specific cysteine residues on target proteins. In Macaca fascicularis, the full-length ZDHHC16 protein consists of 377 amino acids with a calculated molecular weight of approximately 46.4 kDa. It contains a characteristic DHHC (Asp-His-His-Cys) zinc finger domain that is essential for its palmitoyltransferase activity . The amino acid sequence reveals a protein structure with multiple transmembrane domains and conserved cysteine-rich regions characteristic of DHHC family enzymes .

What are the optimal storage conditions for maintaining recombinant ZDHHC16 stability?

Recombinant ZDHHC16 from Macaca fascicularis is typically stored in a Tris-based buffer with 50% glycerol. For short-term storage (up to one week), the protein can be maintained at 4°C as working aliquots. For extended storage, the recommended temperature is -20°C, while long-term archival storage should be at -20°C or -80°C . It is critically important to avoid repeated freeze-thaw cycles as these can significantly compromise protein stability and enzymatic activity . Researchers should make small working aliquots before freezing to minimize freeze-thaw events.

How does the amino acid sequence of Macaca fascicularis ZDHHC16 compare to human ZDHHC16?

The Macaca fascicularis ZDHHC16 shares high sequence homology with human ZDHHC16, as expected for orthologous proteins between closely related primate species. The full amino acid sequence of Macaca fascicularis ZDHHC16 is: "MRGQRSLLLGPARLCLRLLLLLGYRRRCPPLLRGLVQRWRYGKVCLRSLLYNSFGGSDTAVDAAFEPVYWLVDNVIRWFGVVFVVLVIVLTGSIVAIAYLCVLPLILRTYSVPRLCWHFFYSHWNLILIVFHYYQAITTPPGYPPQGRNDIATVSICKKCIYPKPARTHHCSICNRCVLKMDHHCPWLNNCVGHYNHRYFFSFCFFMTLGCVYCSYGSWDLFREAYAAIEKMKQLDKNKLQAVANQTYHQTPPPIFSFRERMTHKSLVYLWFLCSSVALALGALTVWHAVLISRGETSIERHINKKERRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTGRHWLTRVLLPSSHLPHGNGMSWEPPPWVTAHSASVMAV" . Comparative analysis shows conserved functional domains between the species, particularly in catalytic regions, suggesting similar enzymatic mechanisms and substrate specificity.

What expression systems are most effective for producing recombinant Macaca fascicularis ZDHHC16?

Based on the available information, E. coli is commonly used as an expression system for recombinant Macaca fascicularis ZDHHC16 production . When expressing this protein in E. coli, researchers typically use a construct with an N-terminal 6xHis-SUMO tag to improve solubility and facilitate purification . For optimal expression, it is advisable to express the extracellular domain (amino acids 24-297) rather than the full-length protein, as membrane proteins with multiple transmembrane domains can be challenging to express in bacterial systems . Alternative expression systems such as mammalian cells (HEK293 or CHO) or insect cells (Sf9 or Hi5) may be appropriate for experiments requiring post-translational modifications or when studying the full-length protein with its transmembrane domains.

What purification strategies yield the highest purity and activity for recombinant ZDHHC16?

Affinity chromatography using the N-terminal 6xHis tag is the primary purification method for recombinant ZDHHC16 . A typical purification protocol involves:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • SUMO protease treatment to cleave the SUMO tag (if tag removal is desired)

  • Size exclusion chromatography for further purification and buffer exchange

This approach typically yields protein with greater than 90% purity as determined by SDS-PAGE . For maintaining enzymatic activity, it's crucial to include stabilizing agents in the buffer (such as glycerol) and to minimize exposure to oxidizing conditions that might affect the cysteine-rich domains. Researchers should verify protein quality through activity assays to ensure the purified protein retains palmitoyltransferase function.

What methodologies are effective for studying ZDHHC16 palmitoyltransferase activity?

Several techniques can be employed to study ZDHHC16 palmitoyltransferase activity:

  • Metabolic labeling with 3H-palmitate: This approach involves incubating cells expressing potential substrates with tritiated palmitate, followed by immunoprecipitation and fluorography. This technique was successfully used to identify ZDHHC16's role in palmitoylating ZDHHC6 .

  • Acyl-RAC (Resin-Assisted Capture): This non-radioactive method enables detection of palmitoylated proteins through thioester bond-specific chemistry and has been applied to ZDHHC16 substrates .

  • Site-specific mutagenesis: Generating cysteine-to-alanine mutations at potential palmitoylation sites on substrate proteins helps identify specific residues modified by ZDHHC16 .

  • Overexpression and knockdown/knockout approaches: These complementary strategies help confirm enzyme-substrate relationships, as demonstrated in studies where ZDHHC16 knockout resulted in loss of ZDHHC6 palmitoylation .

For kinetic measurements, researchers should consider establishing in vitro assays using purified components to determine parameters such as Km and Vmax for specific substrates.

What is the role of ZDHHC16 in palmitoylation cascades?

ZDHHC16 has been identified as an upstream palmitoyltransferase in a novel palmitoylation cascade. Studies have shown that ZDHHC16 palmitoylates another palmitoyltransferase, ZDHHC6, on its SH3_2 domain cysteines . This represents the first documented case of a palmitoylation cascade, similar to phosphorylation cascades in signal transduction pathways. The palmitoylation of ZDHHC6 by ZDHHC16 regulates ZDHHC6's function, localization, and stability . This hierarchical arrangement of palmitoyltransferases creates an additional regulatory layer in protein palmitoylation processes, allowing for more precise control of cellular palmitoylation events.

How does ZDHHC16 interact with ZDHHC6 and what are the implications of this interaction?

ZDHHC16 physically interacts with ZDHHC6 as demonstrated through co-immunoprecipitation experiments . This interaction facilitates the palmitoylation of ZDHHC6 on all three cysteine residues in its SH3_2 domain . Importantly, there appears to be not only a physical but also a genetic interaction between these enzymes, as ZDHHC6 silencing or knockout leads to increased ZDHHC16 mRNA levels . This suggests a feedback regulatory mechanism where ZDHHC6 may influence ZDHHC16 expression. The interaction between these two palmitoyltransferases has significant implications for understanding how the broader palmitoylation network is regulated and coordinated within cells.

What is the subcellular localization of ZDHHC16 and how does it relate to its function?

ZDHHC16 primarily localizes to the endoplasmic reticulum (ER) and Golgi apparatus . This localization is consistent with its role in palmitoylating ZDHHC6, which is known to modify key proteins in the endoplasmic reticulum . The compartmentalization of ZDHHC16 helps ensure the spatial regulation of palmitoylation events, targeting specific substrates in distinct cellular compartments. Unlike some other DHHC family members, ZDHHC16 itself does not appear to be palmitoylated in HeLa cells, as determined by both 3H-palmitate incorporation and Acyl-RAC techniques . This subcellular restriction likely contributes to the specificity of ZDHHC16's palmitoyltransferase activity.

How do researchers distinguish between direct and indirect substrates of ZDHHC16?

Distinguishing direct from indirect substrates of ZDHHC16 requires a multi-faceted experimental approach:

  • In vitro palmitoylation assays: Using purified recombinant ZDHHC16 and candidate substrate proteins to determine direct enzymatic activity.

  • Substrate trapping mutants: Creating catalytically inactive ZDHHC16 mutants that can bind but not modify substrates, then identifying trapped substrate proteins.

  • Proximity labeling techniques: Employing BioID or APEX2-based approaches to identify proteins in close proximity to ZDHHC16 in living cells.

  • Temporal analysis of palmitoylation dynamics: Monitoring the kinetics of substrate palmitoylation following ZDHHC16 activation or inhibition to distinguish direct (rapid) from indirect (delayed) effects.

  • Competition assays: Determining if potential substrates compete with known direct substrates of ZDHHC16, such as ZDHHC6.

For Macaca fascicularis ZDHHC16, researchers should consider whether findings from human or other mammalian systems are applicable, given the high degree of conservation among orthologous proteins .

What methods can be used to investigate the quaternary structure of ZDHHC16?

Based on research with related DHHC enzymes, several approaches can be used to study ZDHHC16 quaternary structure:

  • Blue native gel electrophoresis: This technique has been used to analyze the oligomeric state of DHHC enzymes and can reveal higher-order structures of ZDHHC16 .

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS): This method provides accurate molecular weight determination of protein complexes in solution.

  • Immunoprecipitation with differently tagged constructs: Co-immunoprecipitation experiments using ZDHHC16 constructs with different epitope tags can demonstrate self-association, as has been shown for related enzymes like ZDHHC6 .

  • Crosslinking mass spectrometry: This approach can identify specific residues involved in protein-protein interactions within ZDHHC16 complexes.

  • Electron microscopy: Negative staining or cryo-EM can provide structural insights into ZDHHC16 oligomers.

Studies with related DHHC enzymes have shown that some family members can dimerize and that this quaternary structure may be influenced by palmitoylation status . Similar patterns might apply to ZDHHC16, making quaternary structure analysis an important aspect of functional studies.

What is the relationship between ZDHHC16 and acyl protein thioesterases in regulating protein palmitoylation dynamics?

The dynamic nature of protein palmitoylation involves both palmitoyltransferases like ZDHHC16 and depalmitoylating enzymes such as acyl protein thioesterases (APTs). Research has shown that while ZDHHC16 mediates the addition of palmitate groups to substrates like ZDHHC6, APT2 is involved in removing these modifications . This creates a dynamic equilibrium that allows rapid interconversion between differently palmitoylated species of substrate proteins. Mathematical modeling combined with kinetic measurements indicates that this interplay between ZDHHC16 and APT2 enables cells to robustly tune the activity of enzymes like ZDHHC6 . Researchers investigating ZDHHC16 should consider this counterbalancing relationship with depalmitoylating enzymes when studying palmitoylation dynamics.

What controls should be included when studying ZDHHC16-mediated palmitoylation?

When investigating ZDHHC16-mediated palmitoylation, researchers should include the following controls:

  • Catalytically inactive ZDHHC16 mutant: A DHHS mutation in the catalytic domain serves as a negative control for palmitoyltransferase activity.

  • Known substrate positive control: Include ZDHHC6 as a positive control substrate, as it has been well-established as a direct target of ZDHHC16 .

  • Non-substrate negative control: Include a protein known not to be palmitoylated by ZDHHC16.

  • Palmitoylation site mutants: For putative substrates, create cysteine-to-alanine mutations at potential palmitoylation sites to confirm specificity.

  • Hydroxylamine sensitivity: Treatment with hydroxylamine cleaves thioester bonds and should remove palmitate modifications, confirming their thioester nature.

  • APT2 inhibition or overexpression: Manipulating the depalmitoylating enzyme provides insight into the dynamic regulation of the modification.

These controls help distinguish specific ZDHHC16-mediated palmitoylation from background signals or effects mediated by other DHHC family members.

What are common technical challenges when working with recombinant ZDHHC16 and how can they be addressed?

Researchers working with recombinant ZDHHC16 frequently encounter these challenges:

  • Protein solubility issues:

    • Challenge: As a membrane-associated protein, ZDHHC16 can have solubility problems.

    • Solution: Use fusion tags like SUMO , optimize detergent conditions, or work with the soluble domains separately.

  • Maintaining enzymatic activity during purification:

    • Challenge: Loss of activity during extraction and purification.

    • Solution: Include reducing agents to protect cysteine residues, minimize time at room temperature, and verify activity after each purification step.

  • Substrate specificity determination:

    • Challenge: Distinguishing true substrates from non-specific palmitoylation.

    • Solution: Use enzyme kinetics, competition assays, and direct comparison with other DHHC enzymes.

  • Reproducing in vivo conditions in vitro:

    • Challenge: Creating an environment that mimics the native membrane context.

    • Solution: Use liposomes or nanodiscs to reconstitute ZDHHC16 in a membrane-like environment.

  • Storage stability:

    • Challenge: Activity loss during storage.

    • Solution: Store at recommended temperatures (-20°C or -80°C), use glycerol as a cryoprotectant , and avoid repeated freeze-thaw cycles.

How can researchers design experiments to identify novel substrates of ZDHHC16?

To identify novel ZDHHC16 substrates, researchers can employ these strategic approaches:

  • Palmitoyl-proteomics: Compare the palmitoyl-proteome in control versus ZDHHC16-knockdown or knockout cells using techniques like acyl-biotin exchange (ABE) or acyl-resin assisted capture (Acyl-RAC) .

  • Proximity-based approaches: Use BioID or APEX2 fusion proteins to identify proteins in close proximity to ZDHHC16 in living cells, which may represent potential substrates.

  • Prediction-based screening: Analyze proteins for characteristic features of ZDHHC16 substrates (based on known targets like ZDHHC6) and test candidates experimentally.

  • Co-immunoprecipitation combined with mass spectrometry: Identify proteins that physically interact with ZDHHC16, particularly when using substrate-trapping mutants.

  • Comparative analysis across species: Leverage the conservation between human and Macaca fascicularis ZDHHC16 to translate findings about substrate specificity across species.

  • Reconstitution experiments: Express ZDHHC16 in cells lacking endogenous ZDHHC16 and identify rescued palmitoylation events.

Each approach has strengths and limitations, so combining multiple methods provides the most robust identification of physiologically relevant ZDHHC16 substrates.

How do findings from Macaca fascicularis ZDHHC16 translate to human systems?

Given the high sequence conservation between Macaca fascicularis and human ZDHHC16 orthologs, many findings are likely transferable between species. The palmitoylation cascade where ZDHHC16 acts upstream of ZDHHC6 was initially characterized in human cells but likely exists in Macaca fascicularis as well. The conserved functional domains, particularly the catalytic DHHC domain, suggest similar enzymatic mechanisms and substrate preferences. Researchers can leverage this conservation to:

  • Validate findings across species

  • Use the monkey protein as a model for human ZDHHC16 function

  • Develop therapeutic strategies targeting conserved mechanisms

What is the current understanding of ZDHHC16's role in cellular and physiological processes?

ZDHHC16 plays crucial roles in several cellular and physiological processes through its palmitoyltransferase activity:

  • Protein localization: By palmitoylating ZDHHC6, ZDHHC16 influences the localization of ZDHHC6 to the endoplasmic reticulum, which subsequently affects the localization and function of ZDHHC6 substrates .

  • Protein stability regulation: ZDHHC16-mediated palmitoylation affects the turnover rate and stability of target proteins like ZDHHC6 .

  • Enzymatic activity modulation: The palmitoylation status of proteins like ZDHHC6 directly impacts their catalytic activity, creating a mechanism for fine-tuning palmitoyltransferase networks .

  • Membrane organization: As a palmitoyltransferase, ZDHHC16 likely influences the organization of membrane microdomains through the palmitoylation of multiple substrate proteins.

These functions collectively contribute to ZDHHC16's role in maintaining cellular homeostasis and responding to changing physiological conditions through dynamic protein palmitoylation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.