Recombinant Macaca fascicularis Protein tweety homolog 1 (TTYH1)

Shipped with Ice Packs
In Stock

Description

Production and Biochemical Properties

The recombinant protein is expressed in E. coli and purified to high purity. While the tag type is not explicitly stated for the Macaca variant, human TTYH1 is often produced with GST or His tags . The protein’s stability is enhanced by glycerol, and repeated freeze-thaw cycles are discouraged .

Functional Insights

  • Ion Transport: TTYH1 facilitates large-conductance chloride currents, critical for maintaining cellular osmotic balance .

  • Membrane Dynamics: Overexpression induces extracellular vesicle (EV) formation and plasma membrane tubulation, suggesting a role in membrane remodeling .

  • Subcellular Localization: Found in dendritic spines, astrocyte processes, and synaptic regions, with distinct distribution patterns in neurons vs. glial cells .

Neural Development and Pathology

ApplicationFindings
Neural Stem CellsTTYH1 maintains quiescence in adult neural stem cells (NSCs); knockout leads to premature activation and neurogenesis .
EpilepsyUpregulated in epileptogenic brain regions; regulates MAP2 distribution in dendritic spines .
Glioma InvasionDrives tumor microtube (TM) formation in gliomas; knockdown reduces TM-mediated invasion and prolongs survival in mouse models .

Molecular Interactions

  • Protein Complexes: Binds ER/Golgi-associated proteins and synaptic markers, suggesting roles in vesicle trafficking and neurotransmission .

  • Calcium Signaling: Regulates NFATc3-mediated calcium signaling to control NSC cycle entry .

Comparative Analysis of TTYH1 Orthologs

SpeciesSourceTagKey Applications
Macaca fascicularisE. coliUndisclosedNeurological disease modeling
Homo sapiensE. coliGST/HisIon channel studies, cancer research
Mus musculusE. coliHisNeurogenesis, epilepsy models

Data compiled from product specifications and functional studies .

Research Implications

TTYH1’s dual roles in neural homeostasis and pathology make it a critical target for therapeutic interventions. Its involvement in glioma invasion and NSC regulation underscores potential applications in oncology and regenerative medicine. Ongoing studies aim to clarify its interaction with cholesterol in membrane bending , which could inform drug development strategies.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please communicate this requirement to us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend incorporating 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag requirements, please inform us and we will prioritize development of the specified tag.
Synonyms
TTYH1; QccE-16395; QccE-16959; Protein tweety homolog 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-450
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
TTYH1
Target Protein Sequence
MGAPPGYRPSAWVHLLHQLPRADFQLRPVPSGFAPQEQEYQQALLLVAALAGLGLGLSLI FIAVYLIRFCCCRPPEPPGSKTPSPGGGCVTWSCIVALLAGCIGIGIGFYGNSETSDGVS QLSSALLHANHTLSAIDHLVLETVERLGEAVRTELTTLEEVLEPRTELVAAARGARRQAE AVAQQLQGLAFWQGVPLSPLQVAEDVSFVEEYRWLAYVLLLLLELLVCLFTLLGLAKQSK WLVIVMTVMSLLVLVLSWGSMGLEAATAVGLSDFYSNPDPYVLNLTQEETGLSSDILSYY FLCNQAVSNPFQQRLTLSQRALANIHSQLLGLEREAVPQFPSAQKPLLSLEETLNVTEGN FHQLVALLHCRGLHKDYGAALRGLCEDALEGLLFLLLFSLLSAGALATALCSLPRAWALF PPSDDYDDTDDDDPFNPQESKRFVQWQSSI
Uniprot No.

Target Background

Function
This protein is a probable chloride channel that may be involved in cell adhesion.
Database Links

KEGG: mcf:101866113

UniGene: Mfa.1387

Protein Families
Tweety family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of TTYH1 protein?

TTYH1 (tweety homolog 1) functions primarily as a calcium(2+)-independent, volume-sensitive large conductance chloride(-) channel. The protein is encoded by a gene with three transcript variants producing distinct isoforms . The genomic structure is conserved across species, with the Macaca fascicularis variant showing high homology to human TTYH1. Functionally, TTYH1 participates in several critical cellular pathways including ion channel transport, stimuli-sensing channels, and transmembrane transport of small molecules . This multifunctional role makes it particularly relevant for neurological research, especially in studies examining ion channel dynamics in primate models.

The protein contains multiple transmembrane domains that form the channel structure, with specific regions responsible for chloride ion selectivity. Understanding this basic structure-function relationship is essential before designing experiments involving recombinant expression or functional modification of the protein.

Which pathways involve TTYH1 and how does it interact with other proteins?

TTYH1 participates in multiple cellular pathways that are critical for neural development and function. The protein is primarily involved in three major pathways: stimuli-sensing channels, transmembrane transport of small molecules, and ion channel transport . Within these pathways, TTYH1 interacts with multiple proteins as summarized in the following table:

Pathway NameProteins Interacting with TTYH1
Stimuli-sensing channelsSRI, ANO8, TTYH2, CLCA1, SLC9A10, ANO10A, ANO5, WNK1, ANO10
Transmembrane transport of small moleculesABCE1, ATP2C2, SLC43A2B, PDZD11, SLC13A2, ATP7B, RHBG, SLC6A19A, CLCN6, TRDN
Ion channel transportTRPC4, TRPM1B, ANO6, TRPM1, CLCN5, TRPV3, GABRR2A, CLCN1, TRPC4B, FXYD7

One of the most significant interactions occurs within the Notch signaling pathway, where TTYH1 functions by reducing Rer1 protein levels through proteasome-dependent degradation . This reduction enhances γ-secretase activity, subsequently strengthening Notch pathway signaling. This mechanism creates a positive feedback loop as TTYH1 is itself a direct transcriptional target of Notch , establishing a reciprocal regulatory relationship that amplifies neural stem cell properties.

How does TTYH1 expression affect neural stem cell properties?

TTYH1 significantly enhances embryonic neural stem cell properties through its regulatory effect on the Notch signaling pathway. When overexpressed, TTYH1 increases the expression of Notch target genes including Hes1, Hes5, and Hey1 in primary neural progenitor cells . This enhancement occurs through TTYH1's ability to strengthen γ-secretase activity, a crucial enzyme complex in the Notch signaling pathway .

In vivo experiments demonstrate that cells overexpressing TTYH1 are predominantly located in the ventricular zone (VZ) and subventricular zone (SVZ) of the developing brain, areas known to contain neural stem cell populations . These TTYH1-expressing cells frequently co-express Sox2, a neural stem cell marker . Conversely, knockdown of TTYH1 using shRNA results in increased cell migration from the VZ/SVZ toward the intermediate zone (IZ), indicating premature differentiation .

The effect of TTYH1 on neural stem cell maintenance can be disrupted by co-expression of dominant negative forms of essential Notch pathway components, such as dominant negative MAML1 (dnMAML1) or dominant negative PS1 (dnPS1) . This confirms that TTYH1's influence on neural stem cell properties is mediated through the Notch signaling pathway rather than through independent mechanisms.

What are the molecular mechanisms behind TTYH1's role in extracellular vesicle formation?

TTYH1 demonstrates a significant capacity to induce the formation of extracellular vesicles (EVs) in cultured mammalian cells, with efficiency comparable or greater than Prominin 1 (Prom1), another known EV inducer . The molecular mechanism involves membrane remodeling, with TTYH1 exhibiting distinct characteristics in the EVs it produces.

TTYH1-induced EVs display more frequent membrane bending compared to Prom1 EVs, suggesting differential mechanisms of membrane curvature induction . Quantitative analysis reveals that TTYH1 is present at approximately fivefold higher concentration in EV membranes compared to Prom1, potentially explaining the increased membrane bending through molecular crowding effects . From identical amounts of transfected cell media, purified EVs contained 8.8 ± 1.0 fold more TTYH1 protein than Prom1, and TTYH1 produced 5.6 ± 0.8 fold more total EV membrane .

The cholesterol composition of the membrane also plays a crucial role in determining EV morphology. While Prom1 EVs become more prone to membrane deformation upon cholesterol depletion (5.4-fold increase in deformed EVs after methyl-beta cyclodextrin treatment), TTYH1 EVs show only a minor 1.4-fold increase under identical conditions . This differential response suggests that TTYH1 may interact differently with membrane cholesterol or may employ alternative mechanisms to stabilize membrane curvature.

When co-expressed, TTYH1 and Prom1 can be found in the same pool of EVs, indicating potential cooperation or at least compatibility in the vesicle formation process . This co-localization opens possibilities for investigating how these proteins might work together in physiological contexts.

How does TTYH1 modulate γ-secretase activity in the Notch signaling pathway?

TTYH1 enhances γ-secretase activity through a mechanism involving the downregulation of Rer1, a protein that functions as a retrieval receptor for γ-secretase components . The process begins with direct binding between TTYH1 and Rer1, as demonstrated by co-immunoprecipitation experiments . This interaction leads to reduced Rer1 protein levels, which was confirmed in primary neural progenitor cells where Ttyh1 expression significantly decreased endogenous Rer1 proteins .

The reduction of Rer1 by TTYH1 is dependent on proteasome function, as treatment with proteasome inhibitors like lactacystin or MG132 restores Rer1 levels to control values . This suggests that TTYH1 promotes the proteasomal degradation of Rer1, thereby reducing its availability to perform its normal function in retrieving γ-secretase components from the Golgi to the ER.

The molecular consequence of reduced Rer1 levels is enhanced γ-secretase activity, which in turn strengthens Notch signaling by increasing the processing of Notch receptors and generation of Notch intracellular domain (NICD). This enhancement is evidenced by increased expression of Notch target genes such as Hes1, Hes5, and Hey1 . The importance of this mechanism is underscored by experiments showing that disruption of γ-secretase activity using dominant negative Presenilin 1 (dnPS1) abolishes TTYH1's ability to enhance neural stem cell properties both in vitro and in vivo .

Interestingly, TTYH1 itself is a direct transcriptional target of Notch , creating a positive feedback loop where Notch activation increases TTYH1 expression, which in turn enhances Notch signaling further. This reciprocal relationship likely plays a crucial role in maintaining neural stem cell properties during brain development.

What are the optimal expression systems for producing recombinant Macaca fascicularis TTYH1?

The optimal expression systems for producing recombinant Macaca fascicularis TTYH1 vary depending on experimental requirements, with several systems demonstrating effectiveness in different contexts. Based on available data and comparable protein expression methods, the following systems have proven successful:

For high-yield production of functional TTYH1, mammalian expression systems such as Expi293 suspension cells offer significant advantages, particularly for studies requiring post-translational modifications and proper protein folding . When working with TTYH1 for EV formation studies, Expi293 cells grown in serum-free media at 37°C with 8% CO₂ provide an optimal environment for protein expression and subsequent vesicle production .

For stable expression, lentiviral transduction methods following established protocols can generate consistent expression levels . This approach is particularly valuable for long-term studies requiring sustained TTYH1 expression. Alternatively, for targeted genomic integration, AAVS1 locus-directed expression using CRISPR-Cas9 technology can establish stable cell lines with controlled expression levels .

For purification purposes, adding affinity tags such as Strep and His tags to the C-terminus of TTYH1 facilitates efficient protein isolation without significantly affecting protein function . When designing expression constructs, consideration should be given to using expression vectors with strong promoters like EF1α for mammalian expression or T7 for bacterial systems .

How can researchers effectively knockdown or overexpress TTYH1 in neural progenitor cell models?

Effective manipulation of TTYH1 expression levels requires careful consideration of the experimental system and specific research questions. For knockdown experiments, short hairpin RNA (shRNA) targeting specific sequences of TTYH1 has proven effective, with knockdown efficiency approaching 50% in neural progenitor cells . When designing shRNA experiments, it is crucial to include controls with shRNA-resistant TTYH1 mutant genes (Ttyh1res) to exclude off-target effects .

For overexpression studies, several approaches have demonstrated success. Transient transfection using Lipofectamine 3000 provides rapid expression but with variable efficiency . For more consistent and long-term expression, lentiviral transduction methods following established protocols offer reliable results . The choice of promoter significantly impacts expression levels, with the EF1α promoter providing robust expression in neural cells .

When targeting specific genomic loci for stable TTYH1 expression, CRISPR-Cas9-mediated integration into the AAVS1 locus provides consistent expression levels . After transfection, selection with appropriate antibiotics (e.g., blasticidin at 10 μg/ml) for approximately 7 days can isolate cells with successful integration .

For in vivo modulation of TTYH1 in developing brain tissue, in utero electroporation offers an effective method to deliver expression constructs or shRNAs to neural progenitor cells. This technique allows for temporal control of expression and can be combined with fluorescent reporters for visualization .

Regardless of the approach, verification of TTYH1 expression changes should employ multiple methods, including quantitative real-time PCR for mRNA levels and Western blotting for protein levels. When assessing functional consequences, examining downstream Notch target genes (Hes1, Hes5, and Hey1) provides reliable readouts of TTYH1 activity .

What are the best methods to isolate and analyze TTYH1-induced extracellular vesicles?

The isolation and analysis of TTYH1-induced extracellular vesicles require specialized techniques to ensure purity and preserve vesicle integrity. For initial production, expression of TTYH1 with C-terminal tags (Strep and His) in Expi293 suspension cells grown in serum-free media provides an optimal system . Following expression, multiple purification steps are necessary to isolate the EVs.

The isolation protocol typically begins with differential centrifugation to remove cells and larger debris from the culture medium. For more refined purification, sequential ultracentrifugation steps (including a final spin at 100,000 × g) effectively concentrate EVs . Size exclusion chromatography can further improve purity by separating EVs from soluble proteins and small contaminants.

For analytical characterization, several complementary techniques provide comprehensive EV assessment:

  • Dynamic Light Scattering (DLS) offers accurate size distribution analysis, with TTYH1 EVs typically measuring 150-200 nm in diameter .

  • Negative Stain Transmission Electron Microscopy (NS-TEM) enables detailed morphological analysis, revealing characteristics such as membrane bending and vesicle structure . This technique is particularly valuable for comparing TTYH1 EVs with those induced by other proteins like Prom1.

  • Western blotting using antibodies against TTYH1 or its tags quantifies protein incorporation into EVs. Comparing protein levels in cellular membranes versus EVs provides insights into secretion efficiency .

  • Membrane dye incorporation using fluorescent lipophilic dyes allows quantification of total membrane content, enabling calculation of protein-to-membrane ratios .

  • Cholesterol content analysis using established assays helps determine lipid composition, which is particularly relevant given the differential response of TTYH1 and Prom1 EVs to cholesterol depletion .

When conducting comparative studies between TTYH1 EVs and other EV populations, consistent purification methods and analytical techniques are essential to avoid methodology-dependent artifacts. For co-expression studies, fluorescent protein tagging (e.g., using StayGold) facilitates live-cell imaging and tracking of EV formation processes .

How can researchers validate the interaction between TTYH1 and Rer1 in experimental settings?

Validating the interaction between TTYH1 and Rer1 requires multiple complementary approaches to confirm both physical binding and functional consequences. Co-immunoprecipitation (co-IP) experiments provide direct evidence of protein-protein interaction, as demonstrated in studies showing that TTYH1 binds directly to Rer1 . For these experiments, epitope-tagged versions of both proteins facilitate detection, but validation with antibodies against endogenous proteins strengthens the physiological relevance of findings.

Deletion mutant analysis helps identify specific domains required for the interaction. Studies have shown that TTYH1Δ2, a deletion mutant lacking a specific domain, fails to reduce Rer1 protein levels, suggesting this region is critical for the functional interaction . Creating a series of deletion constructs can systematically map the interaction interface between TTYH1 and Rer1.

To establish the functional consequence of this interaction, researchers should monitor Rer1 protein levels following TTYH1 overexpression or knockdown. Western blot analysis has shown that endogenous Rer1 proteins decrease significantly upon TTYH1 expression and increase up to twofold following TTYH1 knockdown . This quantitative assessment should be performed in relevant cell types, such as primary neural progenitor cells.

The mechanism of Rer1 reduction can be investigated using proteasome inhibitors such as lactacystin or MG132. Treatment with these inhibitors restores Rer1 levels in TTYH1-expressing cells, indicating proteasome-dependent degradation . Protein stability assays following cycloheximide treatment can further assess whether TTYH1 affects Rer1 protein half-life.

To connect this interaction to downstream functional outcomes, researchers should measure γ-secretase activity and Notch signaling outputs. Quantitative PCR analysis of Notch target genes (Hes1, Hes5, and Hey1) provides a reliable readout of pathway activation . Additionally, rescue experiments where Rer1 is overexpressed alongside TTYH1 can determine if the enhanced Notch signaling is reversed, confirming the specificity of the TTYH1-Rer1-Notch axis.

What are common challenges in purifying recombinant TTYH1 and how can they be addressed?

Purification of recombinant TTYH1 presents several challenges due to its multiple transmembrane domains and integral membrane protein nature. One major challenge is achieving proper folding and membrane insertion when expressed in heterologous systems. To address this, mammalian expression systems like Expi293 cells are preferred over bacterial systems for full-length TTYH1 expression , as they provide the necessary cellular machinery for correct post-translational modifications and membrane protein processing.

Solubilization represents another significant challenge, as membrane proteins require detergents for extraction from cellular membranes. Selecting appropriate detergents is critical - mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin often preserve protein structure and function better than harsher ionic detergents. Optimization of detergent type, concentration, and solubilization conditions through small-scale pilot experiments is recommended before large-scale purification.

Affinity tag selection significantly impacts purification efficiency. C-terminal Strep and His tags have proven effective for TTYH1 purification without compromising function . Positioning tags at the C-terminus rather than N-terminus may prevent interference with signal peptide processing. When designing tagged constructs, including a flexible linker between the protein and tag can improve tag accessibility during purification.

Low expression levels often limit yield. This can be addressed through codon optimization for the expression host, use of strong promoters like EF1α for mammalian expression , and optimization of culture conditions including temperature, induction timing, and duration. For stable expression, selection of high-expressing clones following lentiviral transduction or CRISPR-mediated integration can significantly improve yield .

Protein aggregation during purification can be minimized by maintaining appropriate buffer conditions, including stabilizing additives such as glycerol or specific lipids. Conducting purification at 4°C and including protease inhibitors helps preserve protein integrity. Size exclusion chromatography as a final purification step separates properly folded protein from aggregates and provides information about the oligomeric state of purified TTYH1.

How do TTYH1 expression levels in Macaca fascicularis compare with human and other model organisms?

Expression patterns of TTYH1 across species reveal both conservation and species-specific variations that are important considerations for translational research. While comprehensive comparative expression data specific to Macaca fascicularis is still emerging, several patterns can be discerned from available information across primates and model organisms.

In primates, including humans and macaques, TTYH1 shows notable expression in neural tissues, particularly during development. The expression patterns in macaque neural stem cells appear similar to those observed in human neural progenitors, with predominant expression in ventricular and subventricular zones of the developing brain . This conservation suggests macaque models may closely recapitulate human TTYH1 function in neural development studies.

At the protein sequence level, Macaca fascicularis TTYH1 demonstrates high homology to human TTYH1, with conservation in key functional domains including transmembrane regions and amino acid residues critical for chloride channel function . This structural conservation supports functional similarity, though species-specific post-translational modifications may create subtle differences in protein activity or regulation.

Expression regulation mechanisms, particularly the relationship with Notch signaling, appear conserved across mammals. The positive feedback loop where TTYH1 enhances Notch signaling and is itself a Notch target gene has been observed in multiple species , suggesting evolutionary conservation of this regulatory mechanism in neural stem cell maintenance.

For experimental applications, recombinant expression systems have successfully produced TTYH1 from various species including human, mouse, rat, and Macaca fascicularis . The availability of expression systems for macaque TTYH1 facilitates comparative studies between human and non-human primate models, enhancing translational relevance of findings.

When designing experiments using recombinant Macaca fascicularis TTYH1, researchers should consider species-specific antibody recognition, as antibodies raised against human TTYH1 may show variable cross-reactivity with the macaque protein despite high sequence similarity. Validation of antibody specificity is essential before embarking on extensive immunological studies.

What are promising applications of TTYH1 research in neurodegenerative disease models?

TTYH1's established roles in neural stem cell regulation and membrane remodeling position it as a promising target for neurodegenerative disease research. The protein's function in modulating the Notch signaling pathway, which is implicated in multiple neurodegenerative conditions, offers several potential therapeutic applications.

In Alzheimer's disease models, TTYH1's ability to enhance γ-secretase activity through Rer1 downregulation presents a unique research angle. Since γ-secretase processes both Notch receptors and amyloid precursor protein (APP), understanding how TTYH1 specifically enhances Notch processing without increasing amyloidogenic APP processing could reveal novel therapeutic strategies. Investigating whether TTYH1 modulation can selectively direct γ-secretase activity toward Notch rather than APP would be particularly valuable.

TTYH1's role in extracellular vesicle formation connects to emerging research on EV-mediated protein spreading in neurodegenerative diseases. The protein's ability to induce EVs with specific morphological characteristics could influence the packaging and spread of pathogenic proteins like tau or α-synuclein. Comparative studies of EVs produced by wild-type versus mutant TTYH1 could reveal mechanisms underlying pathological protein propagation.

The development of selective TTYH1 modulators could provide new therapeutic tools. Since TTYH1 functions as a volume-sensitive chloride channel , compounds targeting its channel function might influence neural progenitor behavior or EV production. High-throughput screening for molecules that selectively modify TTYH1 channel properties without affecting other chloride channels would be a valuable research direction.

Using non-human primate models like Macaca fascicularis for TTYH1 studies offers advantages in translational research. The high conservation between macaque and human TTYH1 makes findings more directly applicable to human conditions compared to rodent models, particularly for therapies targeting the protein or its downstream pathways.

How might the EV-inducing properties of TTYH1 be harnessed for therapeutic delivery systems?

The ability of TTYH1 to efficiently induce extracellular vesicle (EV) formation presents significant opportunities for developing advanced therapeutic delivery systems. TTYH1-induced EVs demonstrate several advantageous properties that could be exploited for drug delivery applications.

TTYH1 produces EVs in greater quantities than other EV-inducing proteins like Prom1, generating 5.6 ± 0.8 fold more total EV membrane from identical amounts of transfected cell media . This higher production efficiency could significantly enhance the scalability of EV-based therapeutic manufacturing. Furthermore, TTYH1 is incorporated into EVs at approximately fivefold higher concentration compared to Prom1 , potentially allowing for greater loading capacity of TTYH1-fused therapeutic proteins.

The unique membrane bending properties of TTYH1-induced EVs might influence cargo loading, release kinetics, and tissue penetration. The increased membrane flexibility could potentially enhance fusion with target cell membranes, improving delivery efficiency. Research exploring the relationship between EV membrane properties and delivery effectiveness would help optimize TTYH1-based systems.

For targeted delivery applications, TTYH1 could be engineered as a fusion protein with targeting moieties such as antibody fragments or peptides. The co-localization of TTYH1 and Prom1 in the same EVs when co-expressed suggests compatibility with other membrane proteins, potentially allowing incorporation of multiple functional components into engineered EVs.

The production system for TTYH1-based therapeutic EVs would likely require optimization of expression levels, as excessive TTYH1 expression might alter EV morphology and function. Inducible expression systems could provide precise control over TTYH1 levels during EV production. Additionally, the choice of producer cell type would significantly impact EV composition and immunogenicity, with autologous patient-derived cells potentially offering advantages for clinical applications.

Scalable manufacturing of TTYH1-induced EVs for therapeutic use would require standardized protocols for consistent production. The established methods using Expi293 suspension cells provide a starting point, but adaptation to GMP-compliant processes would be necessary for clinical translation. Purification techniques combining ultracentrifugation and size exclusion chromatography would need optimization to maintain EV integrity while achieving pharmaceutical-grade purity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.