Recombinant Macaca fascicularis Regulator of microtubule dynamics protein 2 (FAM82A1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
RMDN2; FAM82A; FAM82A1; QtsA-11631; QtsA-13801; QtsA-15186; QtsA-20236; Regulator of microtubule dynamics protein 2; RMD-2; Protein FAM82A1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-410
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
RMDN2
Target Protein Sequence
MPHSTNKELIFGIMVGTAGISLLLLWYHKVRKPEKTMKLPKFLSLDNTFNSITLQDEVHN DQGTTVIFQERQLQILEKLNELLTNMEELKEEIRFLKETVPKLEEYIQDELGGKITVHKV SPQHRARKRRLPTIQSSATSNSSEEAESEGGYITANTDTEEQSFPVPKAFNTHVEELNLD VLLQKVDHLRMSESGKSESFELLCDHKEKFRDKIEFMWRFARAYGDMYELSTNTQEKKHY ANIGRTLSERAINRAPMNGHCHLWYAVLCGYVSEFEGLQNKINYGHLFKEHLDIAIKLLP EEPFLYYLKGRYCYTVSKLSWIEKKMAATLFGKIPSSTVQEALHNFLKAEELCPGYSNPN YMYLAKCYADLEENQNALKFCNLALLLPTVTKEDKEAQKEMQKIMTSLKR
Uniprot No.

Target Background

Database Links

UniGene: Mfa.3324

Protein Families
RMDN family
Subcellular Location
Membrane; Single-pass membrane protein. Cytoplasm. Cytoplasm, cytoskeleton, spindle. Cytoplasm, cytoskeleton, spindle pole.

Q&A

What are the recommended storage conditions for recombinant FAM82A1?

For optimal stability and activity of recombinant FAM82A1, the following storage conditions are recommended:

  • Store the protein at -20°C for regular use, or at -80°C for extended storage .

  • The protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized for protein stability .

  • Avoid repeated freeze-thaw cycles as they can degrade the protein structure and reduce activity .

  • For working solutions, store aliquots at 4°C for up to one week .

  • When preparing aliquots for storage, consider adding glycerol to a final concentration of 50% to prevent freeze-thaw damage .

For methodological considerations, always centrifuge the vial briefly before opening to bring contents to the bottom . Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Consider using smaller aliquots for routine experiments to avoid repeated freezing and thawing of the entire stock.

What is the difference between FAM82A1 and RMDN2 nomenclature?

The protein referred to as FAM82A1 (Family with sequence similarity 82, member A1) has been reclassified in more recent nomenclature as RMDN2 (Regulator of Microtubule Dynamics 2). This reflects a shift from sequence-based naming (FAM) to function-based naming (RMDN) .

In the scientific literature, you may encounter both designations:

  • FAM82A1 is the original gene family designation based on sequence similarity

  • RMDN2 is the current approved gene symbol that reflects the protein's function in regulating microtubule dynamics

  • RMD-2 is a commonly used short name

When searching databases or literature, use both FAM82A1 and RMDN2 as search terms to ensure comprehensive results. Include synonyms such as "Regulator of microtubule dynamics protein 2" and "RMD-2" for complete coverage . Note that older publications will primarily use the FAM82A1 designation.

What are the optimal conditions for reconstituting recombinant FAM82A1?

Proper reconstitution of recombinant FAM82A1 is critical for maintaining protein activity. Based on best practices for similar recombinant proteins:

  • Centrifuge the vial briefly before opening to ensure the protein is at the bottom of the container .

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Allow the protein to dissolve completely by gentle mixing (avoid vortexing which may lead to denaturation).

  • For long-term storage after reconstitution, add glycerol to a final concentration of 50% and store in aliquots at -20°C or -80°C .

  • When preparing working solutions, dilute in an appropriate buffer that maintains physiological pH (typically 7.2-7.4).

For experimental applications, ensure the buffer used for final dilution is compatible with your experimental system. Consider potential interference from components in the storage buffer when designing experiments. The protein is typically supplied in a Tris-based buffer with 50% glycerol, which should be taken into account when planning downstream applications .

How can expression systems affect the properties of recombinant FAM82A1?

The choice of expression system significantly impacts the properties and functionality of recombinant FAM82A1:

  • E. coli Expression System:

    • Advantages: High yield, cost-effective, rapid production

    • Limitations: Lacks post-translational modifications, potential folding issues

    • Best for: Initial structural studies, antibody production, interaction studies

    • Validated for: Bovine FAM82A1 variants

  • Mammalian Expression Systems:

    • Advantages: Proper folding, native post-translational modifications

    • Limitations: Lower yield, higher cost, longer production time

    • Best for: Functional studies, cell-based assays, more physiologically relevant protein

    • Recommended for: Studies requiring authentic protein activity

When selecting an expression system, consider:

  • Your experimental goals (structural vs. functional studies)

  • Required post-translational modifications

  • Protein solubility and folding requirements

  • Scale of production needed

The tag type used in the recombinant protein (such as His-tag) will be determined during the production process and may affect protein behavior in certain assays . Validation of protein activity should be performed regardless of the expression system used.

What considerations are important when comparing FAM82A1 across different species?

When comparing FAM82A1/RMDN2 across different species (such as human, macaque, bovine, and mouse), researchers should consider:

  • Sequence Homology Analysis:

    • The Macaca fascicularis FAM82A1 sequence shows significant conservation with other mammalian orthologs

    • Focus experimental designs on both highly conserved domains (for general function) and divergent regions (for species-specific functions)

  • Expression System Standardization:

    • Use consistent expression systems when comparing proteins from different species

    • For Macaca fascicularis FAM82A1, appropriate systems include E. coli and mammalian cells

    • Consider that the bovine ortholog has been successfully expressed in E. coli

  • Functional Comparisons:

    • Design assays that can be consistently applied across all species variants

    • Control for buffer components and experimental conditions

    • Include appropriate positive and negative controls for each species

SpeciesProduct AvailabilitySequence RegionUniProt IDRecommended Storage
Macaca fascicularis50 μg recombinant protein1-410 (full length)Q95LL7-20°C/-80°C
BovineFull length (1-410)1-410Q2TBQ7-20°C/-80°C

Cross-species studies should account for potential functional differences despite sequence similarity, and experimental conditions should be optimized for each species variant while maintaining comparative parameters .

How can researchers effectively design mutation studies for FAM82A1?

Designing effective mutation studies for FAM82A1 requires strategic targeting of functional domains:

  • Target Selection Strategy:

    • Focus on highly conserved residues across species, which suggest functional importance

    • Analyze the full amino acid sequence (MPHSTNKELIFGIMVGTAGISLLLLWYHKVRKPEKT...) to identify potential functional motifs

    • Consider known splice junctions, as seen in zebrafish models where splice site mutations have been documented

  • Mutation Types and Their Applications:

    • Nonsense mutations: To study complete loss of specific domains (as in zebrafish alleles sa17789, sa22368)

    • Essential splice site mutations: To study alternative splicing effects (as in zebrafish allele sa22369)

    • Alanine scanning: Systematically replace charged residues to identify functional surfaces

    • Phosphomimetic mutations: Replace potential phosphorylation sites with aspartate/glutamate to mimic constitutive phosphorylation

  • Experimental Design Framework:

    • Create multiple mutation constructs in parallel for comparative analysis

    • Include both predicted active site mutations and control mutations in non-conserved regions

    • Design rescue experiments using wild-type protein to confirm specificity

    • Consider species-specific differences when translating findings across models

  • Available Mutant Resources:

    • Zebrafish models with specific mutations are available for shipment from repositories

    • These include essential splice site mutation (sa22369) and nonsense mutations (sa17789, sa22368)

    • Such models provide valuable in vivo systems to validate in vitro findings

What approaches can be used to study FAM82A1 interactions with microtubules?

Studying FAM82A1 interactions with microtubules requires specialized approaches:

  • In Vitro Binding Assays:

    • Co-sedimentation with purified tubulin

    • Surface plasmon resonance to measure binding kinetics

    • Microscale thermophoresis for quantitative binding parameters

    • Fluorescence anisotropy with labeled protein domains

  • Structural Analysis Methods:

    • The full amino acid sequence (410 residues) provides the basis for structural predictions

    • Identify potential microtubule-binding domains through bioinformatic analysis

    • Compare with known microtubule-binding proteins to identify structural similarities

  • Cellular Imaging Approaches:

    • Co-localization studies with tubulin using immunofluorescence

    • Live-cell imaging with fluorescently tagged FAM82A1 to track dynamics

    • Fluorescence recovery after photobleaching (FRAP) to measure binding dynamics

    • Super-resolution microscopy to visualize precise localization patterns

  • Domain Mapping Strategy:

    • Create truncation constructs to identify minimal binding domains

    • Design competition assays with known microtubule-binding proteins

    • Use cross-linking mass spectrometry to identify contact residues

    • Develop peptide mimetics of binding domains to validate interactions

The recombinant protein's full-length nature (1-410 amino acids) makes it suitable for comprehensive interaction studies, while its specific buffer requirements (Tris-based buffer with 50% glycerol) should be considered when designing experimental protocols .

How can zebrafish models advance our understanding of FAM82A1 function?

Zebrafish models offer valuable tools for studying FAM82A1 function in vivo:

  • Available Genetic Resources:

    • Three distinct alleles (sa22369, sa17789, sa22368) targeting the FAM82A1 gene in zebrafish are available

    • These include essential splice site and nonsense mutations

    • All three alleles are available for shipment from zebrafish mutation repositories

  • Methodological Advantages of Zebrafish:

    • Transparent embryos allow for in vivo imaging of microtubule dynamics

    • Rapid development enables efficient phenotypic screening

    • Amenable to genetic manipulation and drug screening

    • Conservation of fundamental cellular processes with mammals

  • Experimental Design Considerations:

    • KASP assays are available for genotyping (KASP Assay ID: 2260-6874.1)

    • Genomic locations are well-mapped across different assemblies (GRCz10: Chr13:41923566; GRCz11: Chr13:42049626)

    • Flanking sequences are available for designing primers and probes

  • Translational Approach:

    • Zebrafish findings can guide subsequent studies in mammalian systems

    • Comparison between zebrafish phenotypes and mammalian cell experiments can validate conserved functions

    • Phenotypic rescue with Macaca fascicularis FAM82A1 can test functional conservation

    • High-throughput drug screening in zebrafish can identify compounds affecting FAM82A1 function

Zebrafish AlleleMutation TypePositionAvailable StatusPotential Application
sa22369Essential Splice SiteExon 2/11Available for shipmentAlternative splicing studies
sa17789NonsenseN/AAvailable for shipmentComplete loss-of-function
sa22368NonsenseN/AAvailable for shipmentDomain-specific analysis

These zebrafish resources provide powerful in vivo systems to complement in vitro studies using recombinant Macaca fascicularis FAM82A1 protein .

What are common challenges when working with recombinant FAM82A1?

Researchers may encounter several challenges when working with recombinant FAM82A1:

  • Protein Stability Issues:

    • Challenge: Decreased activity after storage or manipulation

    • Solution: Store at recommended temperatures (-20°C or -80°C)

    • Avoid repeated freeze-thaw cycles

    • Add glycerol to a final concentration of 50% for long-term storage

    • Store working aliquots at 4°C for no more than one week

  • Buffer Compatibility Problems:

    • Challenge: Interference from storage buffer components in downstream assays

    • Solution: Consider the Tris-based buffer with 50% glycerol in experimental design

    • Test buffer exchange methods if necessary

    • Include appropriate buffer-only controls in all experiments

    • Perform pilot experiments to assess buffer effects on assay systems

  • Expression System Limitations:

    • Challenge: Differences in post-translational modifications between expression systems

    • Solution: Choose expression systems based on experimental requirements

    • E. coli systems provide high yield but lack mammalian modifications

    • Validate protein activity regardless of expression system

    • Consider species-specific differences when interpreting results

  • Reconstitution Difficulties:

    • Challenge: Incomplete solubilization or protein aggregation

    • Solution: Follow recommended reconstitution protocols

    • Use gentle mixing rather than vortexing

    • Centrifuge briefly before opening vials

    • Reconstitute at recommended concentrations (0.1-1.0 mg/mL)

Understanding these challenges and implementing appropriate mitigation strategies will enhance experimental success when working with recombinant FAM82A1 from Macaca fascicularis.

How should researchers approach data variability in FAM82A1 functional studies?

When confronting data variability in FAM82A1 functional studies:

  • Source Variability Assessment:

    • Evaluate batch-to-batch consistency of recombinant protein

    • Document protein storage history and conditions

    • Consider expression system differences (E. coli vs. mammalian)

    • Track protein age and freeze-thaw cycles

  • Experimental Design Strategies:

    • Implement randomized block designs to control for batch effects

    • Include technical and biological replicates in all experiments

    • Perform experiments across multiple days/batches to assess reproducibility

    • Use positive and negative controls in each experimental run

  • Statistical Analysis Approaches:

    • Apply appropriate statistical tests based on data distribution

    • Consider using nested ANOVA to account for batch effects

    • Implement mixed-effects models for complex experimental designs

    • Report both statistical and biological significance

    • Present raw data alongside summarized results when possible

  • Standardization Methods:

    • Develop standard operating procedures for protein handling

    • Establish internal reference standards for activity assays

    • Use consistent buffer compositions across experiments

    • Normalize data to internal controls when appropriate

By systematically addressing sources of variability and implementing robust experimental designs, researchers can minimize irreproducibility in FAM82A1 functional studies and generate more reliable and interpretable data.

What controls should be included in FAM82A1 interaction studies?

Robust controls are essential for valid interpretation of FAM82A1 interaction studies:

  • Negative Controls:

    • Buffer-only controls to assess background binding

    • Irrelevant proteins of similar size/properties to test specificity

    • Heat-denatured FAM82A1 to distinguish structural from non-specific interactions

    • Empty vector controls in expression studies

    • Non-targeting siRNA/shRNA in knockdown studies

  • Positive Controls:

    • Known microtubule-binding proteins to validate assay conditions

    • Previously validated interaction partners if available

    • Different concentrations of FAM82A1 to establish dose-response relationships

    • Commercial FAM82A1 from different species to assess conservation of interactions

  • Specificity Controls:

    • Competition assays with unlabeled proteins

    • Domain deletion mutants to map interaction regions

    • Point mutations in predicted binding interfaces

    • Antibody blocking experiments to confirm epitope specificity

  • Technical Validation Controls:

    • Reverse co-immunoprecipitation to confirm interaction directionality

    • Alternative detection methods (Western blot, mass spectrometry, ELISA)

    • In vitro vs. cellular system comparisons

    • Cross-linking controls to distinguish direct from complex-mediated interactions

The 50 μg quantity of recombinant protein typically supplied should be sufficient for multiple control experiments when properly aliquoted and stored . Designing experiments with appropriate controls from the outset will strengthen data interpretation and increase confidence in the reported interactions.

How can FAM82A1 research contribute to understanding neurological disorders?

FAM82A1/RMDN2 research has significant potential to advance understanding of neurological disorders:

  • Microtubule Regulation in Neurodegeneration:

    • Microtubule dynamics are crucial for neuronal function and axonal transport

    • FAM82A1's role as a regulator of microtubule dynamics (RMD-2) makes it relevant to neurodegenerative processes

    • Studying the protein's full sequence (410 amino acids) can identify domains critical for neuronal function

    • Comparative studies between healthy and disease states can reveal pathological mechanisms

  • Experimental Approaches:

    • Recombinant protein can be used in in vitro assays to study interactions with neural proteins

    • Zebrafish models with FAM82A1 mutations provide in vivo systems to study neurological phenotypes

    • Cross-species comparisons (using macaque, bovine orthologs) can identify evolutionary conserved functions

    • Splice site mutations (as in zebrafish model sa22369) can investigate alternative splicing effects in neural tissue

  • Translational Potential:

    • Identification of FAM82A1-targeting compounds may lead to novel therapeutic approaches

    • Understanding interaction networks could reveal new drug targets

    • Genetic variants might serve as biomarkers for disease susceptibility

    • Protein-based interventions could modulate microtubule dynamics in disease states

By leveraging recombinant protein resources and genetic models, researchers can explore FAM82A1's role in neurological disorders and potentially develop novel therapeutic strategies.

What emerging technologies can advance FAM82A1 functional studies?

Several cutting-edge technologies can significantly advance our understanding of FAM82A1 function:

  • Advanced Imaging Techniques:

    • Super-resolution microscopy to visualize FAM82A1-microtubule interactions at nanoscale resolution

    • Live-cell single-molecule tracking to monitor protein dynamics in real time

    • Correlative light and electron microscopy to link function with ultrastructural localization

    • Label-free imaging techniques to avoid fluorescent tag interference

  • Computational and Structural Approaches:

    • Molecular dynamics simulations using the full amino acid sequence (MPHSTNKELIFGIMVGTAGISLLLLWYHKVRKPEKT...)

    • AlphaFold-based structure prediction to model protein domains

    • Virtual screening for compounds that might modulate FAM82A1 function

    • Network analysis to predict functional interactions

  • Genome Editing Technologies:

    • CRISPR-Cas9 to create precise mutations mirroring those in zebrafish models

    • Base editing for introducing specific amino acid changes

    • Prime editing for complex modifications without double-strand breaks

    • Inducible systems for temporal control of gene expression

  • Proteomics Applications:

    • Proximity labeling to identify the FAM82A1 interactome in different cellular contexts

    • Crosslinking mass spectrometry to map interaction interfaces

    • Thermal proteome profiling to assess stability and binding events

    • Post-translational modification mapping to identify regulatory sites

These emerging technologies, when applied to the study of recombinant Macaca fascicularis FAM82A1, can reveal new insights into its function, regulation, and potential roles in health and disease.

How should researchers design comparative studies between recombinant and endogenous FAM82A1?

Designing robust comparative studies between recombinant and endogenous FAM82A1 requires careful methodological considerations:

  • Expression Level Normalization:

    • Quantify endogenous FAM82A1 levels in target cells/tissues

    • Titrate recombinant protein to physiologically relevant concentrations

    • Use quantitative western blotting with standard curves for accurate comparison

    • Consider the impact of overexpression artifacts in transfection studies

  • Functional Activity Assessment:

    • Develop assays that can measure the same parameters for both protein sources

    • Compare microtubule binding affinities and effects on dynamics

    • Evaluate protein-protein interactions with known partners

    • Assess subcellular localization patterns

  • Post-translational Modification Analysis:

    • Characterize modifications present on endogenous protein

    • Determine modification status of recombinant protein from different expression systems

    • Consider how the expression system (E. coli vs. mammalian cells) affects modifications

    • Use modification-specific antibodies or mass spectrometry for detection

  • Experimental Design Considerations:

    • Include proper controls for recombinant protein (storage buffer, tag-only controls)

    • Use multiple biological replicates for endogenous protein analysis

    • Account for cell type-specific differences in endogenous expression and function

    • Consider leveraging zebrafish models for in vivo validation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.