Recombinant Macaca fascicularis Short-chain dehydrogenase/reductase family 42E member 1 (SDR42E1)

Shipped with Ice Packs
In Stock

Description

General Information

Macaca fascicularis Short-chain dehydrogenase/reductase family 42E member 1 (SDR42E1) is a protein-coding gene in crab-eating macaque (Macaca fascicularis) . The human form of SDR42E1 is also a protein-coding gene . Short-chain dehydrogenases/reductases (SDRs) are one of the oldest and most heterogeneous superfamilies of proteins . SDR42E1 belongs to this superfamily .

Basic Characteristics

CharacteristicDescription
SpeciesMacaca fascicularis (Crab-eating macaque/Cynomolgus monkey)
Protein NamesShort-chain dehydrogenase/reductase family 42E member 1
EC Number1.1.1.-
Gene NameSDR42E1
ORF NamesQtsA-14586
Expression Region1-393
AA SequenceMDPKRSQKETVLITGGGGYFGFRLGCALNQKGVHVILFDISSPAETIPEGIKFIQGDICHLSDIEKAFQDADITCVFHIASYGMSGREQLNRNLIEEVNIGGTDNILQACQRRRVPRLVYTSTFNVIFGGQVIRNGDESLPYLPLHLHPDHYSRTKSIAEKKVLEANGTPLDRGDGVLRTCALRPAGIYGPGEQRHLPRIVSYIEKGLFKFVYGDPRSLVEFVHVDNLVQAHILASEALRADKGHIASGQPYFISDGRPVNNFEFFRPLVEGLGYTFPSTRLPLTLVYCFAFLTEMVHFILGRLYNFQPFLTRTEVYKTGVTHYFSLEKAKKELGYKAQPFDLQEAVEWFKAHGHGRSSGSRDSECFIWDGLLVFLLIIAVLIWLPSSVILSL
UniProt NumberQ4R7R1

Function and Evolution

SDRs are a superfamily of proteins, and their classification can be problematic because of the low percentage of identity, even within families . Human SDR42E1 is an active retrogene and not a duplicated form of the SDR42E2 gene .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SDR42E1; QtsA-14586; Short-chain dehydrogenase/reductase family 42E member 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-393
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
SDR42E1
Target Protein Sequence
MDPKRSQKETVLITGGGGYFGFRLGCALNQKGVHVILFDISSPAETIPEGIKFIQGDICH LSDIEKAFQDADITCVFHIASYGMSGREQLNRNLIEEVNIGGTDNILQACQRRRVPRLVY TSTFNVIFGGQVIRNGDESLPYLPLHLHPDHYSRTKSIAEKKVLEANGTPLDRGDGVLRT CALRPAGIYGPGEQRHLPRIVSYIEKGLFKFVYGDPRSLVEFVHVDNLVQAHILASEALR ADKGHIASGQPYFISDGRPVNNFEFFRPLVEGLGYTFPSTRLPLTLVYCFAFLTEMVHFI LGRLYNFQPFLTRTEVYKTGVTHYFSLEKAKKELGYKAQPFDLQEAVEWFKAHGHGRSSG SRDSECFIWDGLLVFLLIIAVLIWLPSSVILSL
Uniprot No.

Target Background

Database Links

KEGG: mcf:101925751

UniGene: Mfa.6940

Protein Families
3-beta-HSD family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is SDR42E1 and what is its primary function in Macaca fascicularis?

SDR42E1 (Short-chain dehydrogenase/reductase family 42E member 1) is a member of the short-chain dehydrogenase/reductase (SDR) superfamily expressed in Macaca fascicularis (cynomolgus monkey). The protein exhibits oxidoreductase activity, acting on the CH-OH group of donors with NAD or NADP as an acceptor . Based on functional predictions and homology studies, SDR42E1 is primarily involved in steroid biosynthetic processes . The enzyme is classified with the EC number 1.1.1.- indicating its role in oxidoreductase reactions . Recent research suggests that SDR42E1 may specifically function in cholesterol metabolism and steroid hormone synthesis pathways that influence both connective tissue maintenance and sexual development . The protein is predicted to be an integral component of cellular membranes, which is consistent with the localization patterns of many steroidogenic enzymes .

How should recombinant Macaca fascicularis SDR42E1 be properly stored and handled in laboratory settings?

For optimal preservation of enzymatic activity and structural integrity, recombinant Macaca fascicularis SDR42E1 should be stored following these guidelines:

Storage ConditionRecommendationDuration
Standard storage-20°CMedium-term
Extended storage-20°C or -80°CLong-term
Working aliquots4°CUp to one week

The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which is optimized to maintain stability . It is crucial to avoid repeated freeze-thaw cycles as they can lead to protein denaturation and loss of enzymatic activity . For experimental protocols, researchers should prepare small working aliquots that can be stored at 4°C for up to one week to minimize freeze-thaw cycles of the main stock .

When handling the protein, maintain aseptic conditions and use low-protein binding tubes to prevent loss due to surface adsorption. For enzymatic assays, the buffer conditions should be optimized based on the specific reaction being studied, with careful consideration of pH, cofactor concentration (NAD+ or NADP+), and potential substrate specificity .

How does Macaca fascicularis SDR42E1 compare to human SDR42E1?

Macaca fascicularis (cynomolgus monkey) SDR42E1 shares significant sequence homology with human SDR42E1, reflecting their evolutionary relationship as primates. Key comparative features include:

FeatureHuman SDR42E1Macaca fascicularis SDR42E1Notes
UniProt IDQ8WUS8Q4R7R1Reference identifiers
Length393 amino acids393 amino acidsConserved protein length
Functional domainsOxidoreductase activity, steroid metabolismOxidoreductase activity, steroid metabolismConserved functional predictions
Associated pathwaysSteroid biosynthesisSteroid biosynthesisSimilar metabolic roles
Clinical significanceMutations linked to oculocutaneous genital syndromeNot extensively characterized in clinical contextHuman mutations show connective tissue and sexual development phenotypes

The high degree of conservation between these proteins makes the cynomolgus monkey an appropriate model organism for studying SDR42E1 function in relation to human diseases. Researchers should note that despite the similarities, species-specific differences may exist in regulatory mechanisms, expression patterns, and precise substrate affinities that should be considered when extrapolating results between species .

What are the expression patterns of SDR42E1 in Macaca fascicularis tissues?

While comprehensive tissue-specific expression data for SDR42E1 in Macaca fascicularis is still being fully characterized, insights can be drawn from both limited macaque studies and related human expression patterns. Based on current evidence:

SDR42E1 is likely expressed in multiple tissues in Macaca fascicularis, with potential enrichment in steroidogenic tissues such as adrenal glands, gonads, and specific brain regions. The expression pattern correlates with tissues involved in steroid hormone synthesis and metabolism . Human SDR42E1 homolog studies indicate expression in connective tissues including cornea and skin, consistent with the phenotypes observed in patients with SDR42E1 mutations who display features of brittle cornea syndrome along with genital abnormalities .

Researchers investigating tissue-specific expression should employ quantitative RT-PCR, RNA-seq, or immunohistochemistry with specific antibodies to accurately characterize SDR42E1 distribution in macaque tissues. When conducting such studies, consideration should be given to potential variations in expression levels based on sex, age, and hormonal status, particularly given the protein's involvement in steroid metabolism .

What methodological approaches can be used to assess the enzymatic activity of recombinant SDR42E1?

To comprehensively characterize the enzymatic activity of recombinant Macaca fascicularis SDR42E1, researchers should implement a multi-faceted approach:

  • Spectrophotometric Assays: Monitor NAD(P)H production/consumption at 340 nm to determine reaction kinetics. This approach requires:

    • Purified recombinant SDR42E1 (50-100 μg per assay series)

    • Various potential steroid substrates (testosterone, progesterone, pregnenolone)

    • NAD+ or NADP+ as cofactors

    • Appropriate buffer conditions (typically pH 7.4-8.0)

    • Temperature control (25-37°C)

  • Liquid Chromatography-Mass Spectrometry (LC-MS): For definitive identification of enzyme products and substrates:

    • Incubate SDR42E1 with candidate substrates

    • Extract metabolites using organic solvents

    • Analyze by LC-MS to identify specific steroid metabolites

    • Compare retention times and mass spectra with authentic standards

  • Isothermal Titration Calorimetry (ITC): To determine binding constants:

    • Measure heat changes upon substrate/cofactor binding

    • Calculate dissociation constants (Kd) for various substrates

    • Compare binding affinities across different steroids

  • Site-Directed Mutagenesis: To identify catalytic residues:

    • Generate mutations at conserved SDR family motifs

    • Assess activity changes to identify critical residues

    • Potential targets include the YxxxK catalytic motif and the TGxxxGxG cofactor binding motif

When investigating substrate specificity, researchers should consider testing a panel of steroids including cholesterol derivatives, sex hormones, and corticosteroids to comprehensively map the enzyme's activity profile. The catalytic efficiency (kcat/Km) for each substrate should be determined to establish preferential activity .

How can genetic modification techniques be applied to study SDR42E1 function in cynomolgus monkeys?

The study of SDR42E1 function in Macaca fascicularis can be significantly advanced through targeted genetic modification approaches:

  • CRISPR/Cas9-Mediated Gene Editing: The most promising approach involves microinjection of Cas9 mRNA and guide RNAs targeting SDR42E1 into one-cell-stage embryos, as demonstrated successfully for other genes in cynomolgus monkeys . Specific strategies include:

    • Knockout Models: Complete gene inactivation to assess loss-of-function phenotypes

    • Knock-in Models: Introduction of specific mutations (e.g., the human p.Arg154Gln variant) to recapitulate disease states

    • Reporter Insertions: Tagging SDR42E1 with fluorescent proteins to monitor expression patterns

  • Viral Vector-Mediated Approaches: For postnatal manipulation in specific tissues:

    • Recombinant adeno-associated viral vectors (rAAV) can deliver modified SDR42E1 variants or shRNAs

    • Mixing different serotypes (e.g., AAV2 and AAV2.retro) can enhance transduction efficiency and circuit-wide expression

    • This approach is particularly useful for studying region-specific effects without germline modification

  • Inducible Expression Systems: To control timing of genetic modifications:

    • Tet-On/Tet-Off systems to regulate SDR42E1 expression

    • Allows temporal control to distinguish developmental versus adult phenotypes

When implementing these approaches, researchers must carefully design control experiments and consider the potential for off-target effects. Comprehensive analysis for off-target mutagenesis should be performed through whole-genome sequencing or targeted deep sequencing of predicted off-target sites . Additionally, researchers must adhere to ethical guidelines for non-human primate research, including protocols for animal welfare monitoring and sample size minimization .

What is the significance of SDR42E1 mutations in relation to connective tissue disorders and sexual development?

Recent investigations have revealed a critical role for SDR42E1 in both connective tissue integrity and sexual development, with important implications for understanding related human disorders:

Human SDR42E1 mutations, particularly the homozygous missense mutation c.461G>A (p.Arg154Gln), have been associated with a novel syndrome characterized by features of brittle cornea syndrome (corneal thinning, blue sclera, keratoconus) alongside genital abnormalities (micropenis, hypospadias, cryptorchidism) . This dual presentation suggests that SDR42E1 functions at the intersection of connective tissue maintenance and steroid hormone pathways.

Stability analysis using the DynaMut web-server demonstrated that the p.Arg154Gln mutation has a destabilizing effect on protein structure with a ΔΔG value of -1.039 kcal/mol, likely impairing enzyme function . Endocrinological investigations in affected individuals revealed low cholesterol levels, indicating that SDR42E1 may play a role in cholesterol homeostasis, which serves as a precursor for steroid hormone synthesis .

Researchers studying Macaca fascicularis SDR42E1 should consider:

  • Examining structure-function relationships through:

    • Comparative modeling of wild-type and mutant forms

    • In vitro enzymatic assays with variant proteins

    • Assessment of substrate specificity changes

  • Investigating the molecular pathway connecting steroid biosynthesis to connective tissue development:

    • Analyzing the effect of SDR42E1 knockdown on collagen synthesis

    • Measuring changes in key steroids with known roles in tissue development

    • Exploring potential transcriptional effects on extracellular matrix genes

The findings from studies in Macaca fascicularis can potentially illuminate pathogenic mechanisms for this newly described human syndrome and provide insights into fundamental biological processes linking steroid metabolism to tissue development .

How can SDR42E1 be incorporated into macaque models of human diseases?

Incorporating SDR42E1 research into macaque disease models offers valuable opportunities for understanding human pathologies, particularly those related to steroid metabolism, connective tissue disorders, and sexual development:

  • Oculocutaneous Genital Syndrome Model:

    • Generate macaques with SDR42E1 mutations mirroring the human p.Arg154Gln variant using CRISPR/Cas9

    • Comprehensively phenotype these animals with ophthalmological, dermatological, and endocrinological assessments

    • Utilize advanced imaging techniques to monitor corneal thickness and structural integrity

    • This model could provide insights into treatment approaches for this rare human syndrome

  • Integration with Existing Neurodegenerative Models:

    • Investigate potential interactions between SDR42E1 and neurodegeneration pathways in established macaque models of Huntington's disease

    • Recent advancements in creating HD macaque models using AAV-mediated expression of mutant HTT offer a platform to study SDR42E1's role

    • Analyze whether SDR42E1 function is altered in neurodegenerative conditions with known steroid metabolism dysregulation

  • Methodological Considerations:

    • Employ standardized phenotyping protocols that include both biochemical measurements (steroid hormone profiles, cholesterol levels) and structural assessments (tissue imaging, biomechanical testing)

    • Incorporate longitudinal monitoring to capture developmental trajectories and age-related changes

    • Utilize multimodal imaging (MRI, DTI) to assess tissue microstructure in vivo, similar to approaches used in neurodegeneration models

When developing these models, researchers should carefully consider genetic background effects and MHC polymorphism, which can significantly impact experimental outcomes in macaque studies . It is also advisable to perform comprehensive genetic characterization of experimental animals, as population-specific genetic variants may modify disease phenotypes .

What challenges exist in developing specific antibodies for SDR42E1 detection in macaque tissue samples?

Developing reliable antibodies for SDR42E1 detection in Macaca fascicularis tissues presents several technical challenges that researchers should address methodically:

  • Sequence Conservation Challenges:

    • The high sequence homology between macaque and human SDR42E1 (>90%) can complicate the development of species-specific antibodies

    • Researchers must carefully identify unique epitopes or use cross-reactive antibodies with validated specificity

    • Epitope mapping is recommended to ensure antibody specificity to SDR42E1 versus other SDR family members

  • Validation Requirements:

    • Multiple validation approaches are essential:

      • Western blotting with recombinant protein as positive control

      • Immunohistochemistry with competing peptide controls

      • Knockout/knockdown tissues as negative controls

      • Mass spectrometry confirmation of immunoprecipitated proteins

  • Technical Protocol Optimization:

    • Tissue fixation significantly impacts epitope accessibility for SDR42E1:

      • For formaldehyde-fixed tissues, antigen retrieval methods must be optimized

      • Epitope masking is common in membrane-associated proteins like SDR42E1

      • Consider using multiple antibodies targeting different epitopes

    • For Western blotting applications, membrane protein extraction protocols require optimization with detergents compatible with antibody binding

  • Antibody Format Selection:

    • Monoclonal antibodies offer consistency but may have limited epitope recognition

    • Polyclonal antibodies provide broader epitope coverage but batch-to-batch variation

    • Recombinant antibodies are emerging as alternatives with consistent properties

A recommended validation workflow includes initial screening with Western blotting against recombinant SDR42E1, followed by immunohistochemistry on tissues with known expression patterns. Mass spectrometry analysis of immunoprecipitated complexes provides definitive confirmation of antibody specificity. Researchers should document thorough validation data to ensure reproducibility and reliability of SDR42E1 detection in experimental studies .

How does MHC polymorphism in cynomolgus macaques impact studies involving SDR42E1?

The significant MHC polymorphism present in cynomolgus macaques has important implications for studies of SDR42E1, particularly those involving immune responses or transplantation:

  • Impact on Experimental Design:

    • MHC polymorphism can introduce variability in immune responses to SDR42E1-targeted interventions

    • Studies involving 84 major MHC class I haplotypes and 16 MHC class I haplotypes have been identified in Filipino cynomolgus macaques alone

    • This genetic diversity necessitates careful matching or stratification of experimental groups

  • Specific Considerations for SDR42E1 Research:

    • For vaccine or immunotherapy studies targeting SDR42E1:

      • MHC-dependent presentation of SDR42E1 peptides affects T-cell responses

      • Different MHC haplotypes may present different immunodominant epitopes

    • For transplantation studies involving tissues with SDR42E1 expression:

      • DRB incompatibility correlates with mixed lymphocyte culture results

      • MHC matching is crucial for interpreting rejection related to SDR42E1 function

  • Methodological Approaches:

    • MHC genotyping should be performed using one of these methods:

      • Sequence-specific PCR

      • Microsatellite analysis

      • Next-generation sequencing

    • Experimental groups should be matched for MHC haplotypes when assessing SDR42E1-related phenotypes

    • For studies with limited animal numbers, statistical methods that account for MHC as a covariate should be employed

  • Population Considerations:

    • Mauritian-origin cynomolgus macaques exhibit limited MHC diversity (7 major haplotypes) and may provide more consistent experimental cohorts

    • Continental vs. island populations show distinct genetic differentiation that extends beyond MHC genes

Researchers studying SDR42E1 in cynomolgus macaques should document MHC genotypes of experimental animals and consider potential MHC effects when interpreting immune-related outcomes. This is particularly important when studying conditions where both steroid metabolism and immune function may interact, such as in inflammatory diseases affecting connective tissues .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.