Recombinant Macaca fascicularis Signal peptidase complex subunit 2 (SPCS2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Macaca fascicularis Signal Peptidase Complex Subunit 2 (SPCS2)

Recombinant Macaca fascicularis Signal Peptidase Complex Subunit 2 (SPCS2) is a synthetically produced protein derived from the Macaca fascicularis, also known as the cynomolgus monkey or crab-eating macaque . SPCS2 is a subunit of the signal peptidase complex (SPC), an enzyme crucial for protein maturation in eukaryotic cells .

Biological Role of SPCS2

The signal peptidase complex (SPC) is responsible for cleaving signal peptides from precursor proteins, a necessary step for proper protein folding and localization . SPCS2 plays a vital role in the function of the SPC . Research indicates that SPCS2 modulates the substrate and cleavage site selection within the SPC . Specifically, it has been shown that the absence or mutation of Spc2 compromises the SPC's ability to discriminate between substrates and identify cleavage sites .

Functional Significance

SPCS2 affects the SPC's preference for signal sequences based on their length . SPCS2 promotes the cleavage of signal sequences with short n-regions (N < 16) and reduces cleavage of those with long n-regions . The C-terminal domain of Spc2 may prevent signal sequences with long n-regions from entering the transmembrane window, making shorter signal peptides preferable substrates for the SPC .

Macaca fascicularis as a Biomedical Model

The Macaca fascicularis is a key non-human primate model in biomedical research because of its physiological similarities to humans . They are used in reproductive studies, pharmaceutical research, infectious disease research, and cardiovascular studies . Their use helps researchers to ensure that new drugs are safe and effective and to understand various diseases .

Applications of Recombinant SPCS2

Recombinant SPCS2 is utilized in research applications to study protein biogenesis and the function of the signal peptidase complex . It can be used in in vitro assays and structural studies to elucidate the mechanisms by which SPC governs protein processing .

Expression and Production

Recombinant SPCS2 is produced through synthetic means and is available for purchase from various suppliers . The protein is expressed, purified, and stored in specific buffers to maintain its stability and activity .

Gene Information

The human SPCS2 gene, for example, is identified by the Gene ID: 9789 . Orthologs of human protein-coding genes, including SPCS2, have been identified in the Macaca fascicularis genome, which aids in the design of species-specific research tools .

SPCS2 and Disease

SPCS2 has been linked to certain diseases . For example, Spinocerebellar Ataxia 13 is associated with the SPCS2 gene . Further research is needed to fully understand the implications of SPCS2 dysfunction in disease development.

Tables of Data

The following tables summarize key data related to SPCS2:

Table 1: SPCS2 General Information

PropertyDescription
NameSignal Peptidase Complex Subunit 2
OrganismMacaca fascicularis (Cynomolgus monkey)
FunctionModulates substrate and cleavage site selection in the signal peptidase complex
участвует вProtein maturation, protein folding, and localization
Связанные заболеванияSpinocerebellar Ataxia 13

Table 3: Experimental Applications of Recombinant SPCS2

ApplicationDescription
In Vitro AssaysUsed to study protein biogenesis and the function of the signal peptidase complex
Structural StudiesEmployed to elucidate mechanisms by which SPC governs protein processing
Drug Safety AssessmentMacaca fascicularis, expressing SPCS2, is used in drug safety assessments due to physiological similarities with humans .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SPCS2; QflA-13117; Signal peptidase complex subunit 2; Microsomal signal peptidase 25 kDa subunit; SPase 25 kDa subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-226
Protein Length
Full Length of Mature Protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
SPCS2
Target Protein Sequence
AAAATQGGRSGGLGGNSGAGGGSNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLD DSAKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISY FVMMGILTIYTSYKEKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRT KQQREAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSLAVERKIK
Uniprot No.

Target Background

Function

A component of the microsomal signal peptidase complex, responsible for removing signal peptides from nascent proteins during their translocation into the endoplasmic reticulum lumen.

Database Links

KEGG: mcf:102116673

UniGene: Mfa.8492

Protein Families
SPCS2 family
Subcellular Location
Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Signal Peptidase Complex Subunit 2 in Macaca fascicularis?

Signal Peptidase Complex Subunit 2 (SPCS2) is a critical component of the Signal Peptidase Complex (SPC) responsible for cleaving signal sequences from secretory proteins. In Macaca fascicularis, as in other eukaryotes, SPCS2 helps distinguish between signal peptides (SPs) and signal-anchored (SAs) sequences, ensuring proper protein processing in the endoplasmic reticulum. Research indicates that SPCS2 modulates the properties of the SPC and its surrounding membrane environment, enhancing the complex's ability to discriminate between these sequences .

The C-terminal cytosolic domain of SPCS2 plays a particularly important role in substrate recognition, as demonstrated in research with the yeast ortholog (Spc2), where this domain was found to be crucial for N-length dependent substrate selection by SPC .

How does SPCS2 contribute to membrane dynamics within the signal peptidase complex?

SPCS2 significantly influences membrane architecture around the SPC. Coarse-grained molecular dynamics (CGMD) simulations of SPC structures show that when SPCS2 is present, it induces membrane thinning at the center of the complex (known as the TM-window). This thinned region is approximately 3Å thinner than in structures lacking SPCS2 .

This membrane modulation is functionally significant as it affects which substrates can access the active site:

  • Shorter signal peptides fit well in the thinned membrane with SPCS2 present

  • Longer hydrophobic regions are accommodated better when SPCS2 is absent and the membrane is thicker

What are the key structural features of recombinant Macaca fascicularis SPCS2?

Recombinant SPCS2 from Macaca fascicularis is characterized by specific functional domains that influence its role in the signal peptidase complex:

  • Transmembrane Domain: Contains transmembrane segments that anchor the protein in the ER membrane

  • C-terminal Cytosolic Domain: Critical for substrate discrimination and recognition

  • Catalytic Region: While not directly containing the catalytic site, SPCS2 influences accessibility to the active site of the complex

The AlphaFold2-predicted structures of SPCS2 (based on studies of the yeast ortholog) show that it constitutes a significant portion of the cytosolic part of SPC, positioning it ideally to interact with the N-terminal regions of signal sequences as they emerge from the translocon .

What expression systems yield the highest quality recombinant Macaca fascicularis SPCS2 for research?

Recombinant Macaca fascicularis SPCS2 can be produced using several expression systems, each with specific advantages for research applications:

Expression SystemAdvantagesTypical YieldPost-translational Modifications
E. coliHigh yield, cost-effective, rapid expressionHighMinimal/None
YeastProper folding, some PTMsModerateBasic eukaryotic modifications
BaculovirusHigh-level expression of complex proteinsModerate-HighAdvanced eukaryotic modifications
Mammalian cellMost native-like protein structure and PTMsLowerFull range of mammalian modifications

For studies focusing on structural analysis without requiring post-translational modifications, E. coli systems typically provide sufficient protein quality. For investigations requiring native-like protein behavior, mammalian expression systems are recommended despite their lower yield .

How can researchers design experiments to investigate SPCS2's role in signal sequence discrimination?

Investigating SPCS2's role in signal sequence discrimination requires a multifaceted experimental approach:

  • Deletion and Mutation Studies:

    • Generate SPCS2 knockout or knockdown models in cell lines

    • Create specific domain mutations, particularly in the C-terminal domain

    • Assess how these alterations affect signal sequence processing

  • Model Substrate Analysis:

    • Design model substrates with varying N-region lengths (the segment preceding the hydrophobic core of signal sequences)

    • Compare processing of substrates with short N-regions (N# < 16) versus long N-regions (N# > 16)

    • Pulse-labeling experiments can capture early stages of protein maturation

  • Molecular Dynamics Simulations:

    • Generate computational models of the membrane-embedded SPC with and without SPCS2

    • Analyze membrane thickness changes and their impact on substrate accessibility

    • Compare simulations with experimental findings to validate hypotheses

Research has shown that SPCS2 promotes cleavage of signal sequences with short N-regions while reducing cleavage of those with long N-regions, suggesting it sharpens discrimination between signal peptides and signal-anchored sequences .

What methodologies are most effective for assessing the interaction between SPCS2 and the translocon complex?

The interaction between SPCS2 and the Sec61 translocon can be studied using these approaches:

  • Co-immunoprecipitation (Co-IP):

    • Use antibodies against SPCS2 or Sec61β subunit to pull down protein complexes

    • Analyze interacting partners by Western blotting or mass spectrometry

  • Proximity Labeling:

    • Utilize BioID or APEX2 tagging of SPCS2

    • Identify proximal proteins through streptavidin pulldown and mass spectrometry

  • Crosslinking Studies:

    • Apply chemical crosslinkers to stabilize transient interactions

    • Analyze crosslinked complexes to map interaction sites

  • Functional Assays:

    • Assess signal sequence processing in cells with mutated SPCS2-translocon interfaces

    • Monitor the unfolded protein response (UPR) activation as an indicator of compromised processing

Previous research has shown that SPCS2 interacts with the β subunit of the Sec61 translocon in yeast and mammals, mediating transient interactions between the SPC and the translocon .

How does the genetic diversity of SPCS2 compare between different macaque species used in laboratory research?

Research using 2b-RAD simplified genome sequencing analyzed 55 laboratory macaques (40 cynomolgus macaques and 15 rhesus macaques) bred in South China. The findings revealed:

  • Laboratory macaques generally showed relatively low genetic diversity at the genomic level

  • Genetic differentiation in Chinese rhesus macaques was higher than in cynomolgus macaques

  • Introgressive hybridization with Chinese rhesus macaques was detected in more than 80% (32/40) of cynomolgus macaques

These patterns likely extend to the SPCS2 gene, suggesting that researchers should be aware of potential genetic variation when using different macaque species for SPCS2 studies. Hybrid introgression may particularly affect genes involved in protein processing pathways, potentially including SPCS2 .

What functional differences exist between SPCS2 in Macaca fascicularis and its human ortholog?

When comparing SPCS2 between Macaca fascicularis and humans, researchers should consider:

  • Sequence Conservation:

    • High degree of sequence similarity between human SPCS2 and macaque SPCS2

    • The AlphaFold2-predicted structures of yeast Spc2 and human SPCS2 show well-conserved structures

  • Functional Conservation:

    • Both proteins play similar roles in signal sequence processing

    • The cytosolic domains constitute a major part of the respective SPCs

  • Species-Specific Differences:

    • Subtle variations may exist in substrate specificity

    • Differences in interaction networks with other cellular components

Understanding these differences is crucial when using macaque models for translational research, as they may affect the interpretation of experimental results and their applicability to human biology .

How can recombinant SPCS2 be utilized in vaccine development research with macaque models?

Recombinant SPCS2 can serve as a valuable tool in vaccine research using macaque models:

  • As a Carrier Protein or Fusion Partner:

    • SPCS2 can be used as a fusion partner for antigenic epitopes

    • The proper folding and processing of such fusion proteins depends on understanding SPCS2 function

  • For Studying Immune Responses:

    • Previous studies with recombinant proteins in cynomolgus macaques have shown that intramuscular immunization can elicit both IgG and IgA responses

    • Research has demonstrated that multi-component recombinant vaccines administered to female cynomolgus monkeys can generate robust immune responses

  • In Comparative Immunology:

    • Understanding macaque-human differences in antibody responses is critical

    • Studies have shown that while macaques and humans share some immune response characteristics, they also recognize distinct regions of viral proteins

The efficacy and safety of recombinant protein vaccines in macaques have been demonstrated in previous studies, where intramuscular administration with aluminum hydroxide adjuvant elicited strong immune responses without discernible adverse effects .

What approaches can researchers use to analyze post-translational modifications of SPCS2 in Macaca fascicularis?

Analyzing post-translational modifications (PTMs) of SPCS2 requires sophisticated methodologies:

  • Mass Spectrometry-Based Approaches:

    • Enrichment strategies for specific PTMs (phosphorylation, glycosylation, etc.)

    • Bottom-up proteomics for identification of modification sites

    • Top-down proteomics for intact protein analysis with modifications

  • Comparative Analysis:

    • Compare PTM patterns between recombinant and native SPCS2

    • Assess differences between SPCS2 from different expression systems

  • Functional Impact Assessment:

    • Site-directed mutagenesis of potential PTM sites

    • Analysis of how PTM changes affect SPCS2's role in signal sequence processing

    • Investigation of how PTMs influence SPCS2's interaction with other SPC components

For recombinant SPCS2 production, the choice of expression system significantly impacts the PTM profile. E. coli-expressed protein will lack eukaryotic modifications, while mammalian cell-expressed protein will most closely resemble the native state .

What strategies can address poor solubility of recombinant Macaca fascicularis SPCS2?

Poor solubility is a common challenge when working with membrane proteins like SPCS2. Researchers can employ several strategies:

  • Optimization of Expression Conditions:

    • Lower induction temperature (16-20°C)

    • Reduced inducer concentration

    • Extended, slow induction period

  • Solubility-Enhancing Tags and Partners:

    • SUMO tag to enhance solubility (as used in some commercial preparations)

    • MBP, Trx, or GST fusion partners

    • Co-expression with chaperones

  • Buffer Optimization:

    • Include glycerol (typically 10-50%) to stabilize the protein

    • Test various detergents for membrane protein solubilization

    • Optimize salt concentration and pH

  • Expression of Functional Domains:

    • Express only the cytosolic domain for interaction studies

    • Use truncation constructs lacking transmembrane segments

Commercial recombinant SPCS2 preparations often use strategies like His-SUMO tagging and glycerol-containing formulations (up to 50% glycerol) to maintain solubility and stability .

What are the most reliable methods for validating antibody specificity against Macaca fascicularis SPCS2 in immunological studies?

Validating antibody specificity for SPCS2 requires rigorous testing:

  • Western Blot Analysis:

    • Test against recombinant SPCS2 and macaque tissue/cell lysates

    • Include negative controls (knockout or knockdown samples)

    • Compare with known SPCS2 molecular weight patterns (typically ~25 kDa)

  • Immunoprecipitation Followed by Mass Spectrometry:

    • Confirm identity of pulled-down proteins

    • Check for expected SPCS2 peptides in the mass spectrum

  • Cross-Reactivity Testing:

    • Test against related proteins to ensure specificity

    • Assess cross-reactivity with human SPCS2 and other macaque species

  • Immunofluorescence with Subcellular Markers:

    • Co-localization with ER markers (SPCS2 should localize to the ER membrane)

    • Absence of signal in SPCS2-depleted cells

Previous immunological studies in macaques have employed rigorous validation protocols, including testing antisera against both recombinant proteins and native proteins in cell/tissue extracts, as well as immunofluorescence localization studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.