Recombinant Macaca fascicularis Sterol O-acyltransferase 1 (SOAT1)

What is Macaca fascicularis SOAT1 and what is its structural composition?

Sterol O-acyltransferase 1 (SOAT1) from Macaca fascicularis (crab-eating macaque or cynomolgus monkey) is an enzyme (EC 2.3.1.26) also known as Acyl-coenzyme A:cholesterol acyltransferase 1 (ACAT-1) or Cholesterol acyltransferase 1. The protein is composed of 550 amino acids and plays a critical role in intracellular cholesterol homeostasis . The full amino acid sequence begins with MVGEEKMSLRNRLSKSRENPEEDEDQRKPAKESLE and continues through the complete 550-residue sequence as documented in UniProt (O77761) .

What is the primary enzymatic function of SOAT1?

SOAT1 catalyzes the formation of cholesterol esters from cholesterol and long-chain fatty acyl-CoA. This enzyme plays a crucial role in cellular cholesterol homeostasis by converting excess free cholesterol (FC) into cholesterol esters (CE) for storage in lipid droplets, thereby preventing potentially cytotoxic accumulation of free cholesterol . The enzyme's activity can be measured through incorporation of [14C]-oleic acid into the esterified cholesterol pool, providing a quantitative assessment of enzymatic function .

How does Macaca fascicularis compare to other species as a model for SOAT1 research?

Macaca fascicularis (cynomolgus monkey) represents one of the most important nonhuman primate animal models in biomedical research. Genome sequencing revealed significant homology to humans with 17,387 orthologs of human protein-coding genes identified in the M. fascicularis draft genome . This high genetic similarity makes cynomolgus monkeys valuable for translational research on cholesterol metabolism. M. fascicularis offers advantages over rodent models due to its closer physiological, metabolic, and genetic relationship to humans, allowing for more precise extrapolation of research findings to human disease contexts .

How can researchers effectively measure SOAT1 activity in experimental systems?

Researchers can quantify SOAT1 activity through several complementary approaches:

• Radioisotope incorporation assay: Measure the incorporation of [14C]-oleic acid into cholesterol esters following treatment with SOAT1 inhibitors or genetic manipulation. In published protocols, cells are treated with SOAT1 inhibitor (SI, 4μM) or DMSO (control) for 48 hours, followed by incubation with [14C]-oleic acid .

• Cholesterol ester quantification: Direct biochemical measurement of cholesterol ester content in cells or tissues provides a functional readout of SOAT1 activity.

• Lipid droplet visualization: Since SOAT1 activity leads to cholesterol ester storage in lipid droplets, quantification of lipid droplets using Nile red or Oil Red O staining can serve as an indirect measure of SOAT1 function .

What experimental systems best model SOAT1 function in disease contexts?

The most effective experimental systems for studying SOAT1 in disease contexts include:

• Cell culture models: Human podocytes have demonstrated utility for investigating SOAT1's role in kidney disease. Primary cells isolated from disease models (such as Alport Syndrome mice) show significantly increased SOAT1 activity compared to wild-type controls, making them valuable for studying disease-specific alterations .

• Genetic knockout/knockdown models: SOAT1-deficient mice (Soat1−/−) provide insights into long-term consequences of SOAT1 deficiency. Double-homozygous disease models (e.g., db/db;Soat1−/− mice) allow examination of how SOAT1 deficiency affects disease progression .

• Pharmacological inhibition studies: Treatment with SOAT1 inhibitors in disease models (demonstrated in both db/db mice and Alport Syndrome models) enables assessment of therapeutic potential .

These complementary approaches provide comprehensive insights into SOAT1 function across different biological contexts.

What approaches can researchers use to investigate the relationship between SOAT1 and ABCA1-mediated cholesterol efflux?

Research has revealed an important interplay between SOAT1 activity and ABCA1-mediated cholesterol efflux. Investigators can explore this relationship through:

• Gene expression analysis: Quantitative real-time PCR to measure ABCA1 mRNA expression following SOAT1 inhibition or genetic deletion. Studies have shown that SOAT1 inhibition significantly increases ABCA1 expression in human podocytes .

• Cholesterol efflux assays: Functional measurement of ABCA1-mediated cholesterol efflux (typically to apolipoprotein A-I) following SOAT1 manipulation. SOAT1 inhibitor-treated human podocytes showed significantly increased ABCA1-mediated cholesterol efflux compared to vehicle-treated controls .

• Combined genetic and pharmacological approaches: Using siRNA to silence ABCA1 in combination with SOAT1 inhibition helps determine whether protective effects are ABCA1-dependent. Research demonstrated that SOAT1 inhibition protected control podocytes from cytotoxicity by approximately 70%, while protection was reduced to 40% in ABCA1-knockdown cells .

What evidence supports SOAT1 as a therapeutic target in kidney disease models?

Extensive experimental evidence supports SOAT1 as a promising therapeutic target:

• Disease-related SOAT1 dysregulation: Primary podocytes isolated from Alport Syndrome mice show significantly increased SOAT1 activity compared to wild-type controls, suggesting pathological upregulation .

• Protective effects of genetic SOAT1 deficiency in diabetic kidney disease:

• Benefits of pharmacological SOAT1 inhibition in Alport Syndrome:

These findings collectively demonstrate that targeting SOAT1-mediated cholesterol metabolism benefits renal function and prevents disease progression in experimental models .

What are the proposed mechanisms by which SOAT1 inhibition provides protection in disease models?

SOAT1 inhibition appears to protect against disease progression through several interconnected mechanisms:

• Reduction of cholesterol ester accumulation: SOAT1 inhibition significantly reduces cholesterol ester content in kidney cortices of disease models, preventing lipotoxicity .

• Enhanced cholesterol efflux: SOAT1 inhibition increases ABCA1 expression and ABCA1/ApoA1-mediated cholesterol efflux, promoting removal of excess cellular cholesterol .

• Prevention of lipid droplet formation: By reducing cholesterol esterification, SOAT1 inhibition decreases lipid droplet content in cells, as demonstrated by reduced Nile red and Oil Red O staining .

• Protection against cellular injury: SOAT1 inhibition protects podocytes from cytotoxicity and apoptosis induced by diabetic sera or disease conditions, preserving cellular function .

• Reduction of tissue remodeling and fibrosis: In Alport Syndrome models, SOAT1 inhibition significantly decreased glomerular and interstitial fibrosis, suggesting effects on pro-fibrotic pathways .

The central mechanism appears to be a shift in cellular cholesterol handling from storage (as cholesterol esters) toward efflux, preventing lipotoxicity and preserving cellular function in disease states.

How should researchers design experiments to evaluate novel SOAT1 inhibitors?

When evaluating novel SOAT1 inhibitors, researchers should implement a comprehensive experimental approach:

• In vitro characterization:

  • Direct measurement of SOAT1 inhibition using [14C]-oleic acid incorporation assays

  • Dose-response curves to determine IC50 values

  • Assessment of effects on cholesterol ester content and lipid droplet formation

  • Evaluation of ABCA1 expression and cholesterol efflux capacity

  • Cytotoxicity profiling at multiple concentrations and exposure times

• Disease-relevant cellular models:

  • Testing in cells exposed to disease-relevant stressors (e.g., diabetic sera for kidney disease models)

  • Comparison of effects in wild-type versus ABCA1-deficient cells to determine mechanism dependence

  • Assessment of protective effects against apoptosis and cellular dysfunction

• In vivo evaluation:

  • Selection of appropriate disease models (e.g., db/db mice for diabetic kidney disease, Alport Syndrome mice)

  • Pharmacokinetic studies to determine dosing regimens

  • Comprehensive outcome assessment including:

    • Disease-specific biomarkers (e.g., albuminuria, BUN, serum creatinine for kidney disease)

    • Tissue cholesterol ester content

    • Histopathological analysis (mesangial expansion, fibrosis, lipid accumulation)

    • Ultrastructural analysis using electron microscopy

    • Gene expression profiling of ABCA1 and related pathway components

• Safety assessment:

  • Monitoring of liver function (ALT concentrations)

  • Assessment of effects on serum lipid profiles

  • Evaluation of potential off-target effects

This systematic approach provides comprehensive characterization of inhibitor efficacy, mechanisms, and therapeutic potential .

What are the optimal storage and handling conditions for recombinant Macaca fascicularis SOAT1 protein?

For maintaining recombinant Macaca fascicularis SOAT1 stability and activity, researchers should adhere to the following storage and handling guidelines:

• Storage buffer: Tris-based buffer containing 50% glycerol, specifically optimized for SOAT1 protein stability .

• Storage temperatures:

  • Short-term storage: -20°C

  • Extended storage: -20°C or -80°C

  • Working aliquots: 4°C for up to one week

• Handling precautions:

  • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

  • Prepare appropriately sized working aliquots upon receipt

  • Thaw frozen stocks rapidly and maintain at recommended temperatures

These conditions are designed to preserve the native conformation and enzymatic activity of the recombinant protein for experimental applications.

What analytical techniques provide the most comprehensive assessment of SOAT1 function?

A multi-method approach provides the most comprehensive evaluation of SOAT1 function:

• Activity assays:

  • Radioisotope incorporation using [14C]-oleic acid

  • Mass spectrometry-based quantification of cholesterol ester species

  • Fluorogenic substrate assays for high-throughput applications

• Expression analysis:

  • qPCR for mRNA quantification

  • Western blotting for protein levels

  • Immunohistochemistry for tissue localization and expression patterns

• Functional consequences:

  • Lipid droplet quantification (Nile red, Oil Red O staining)

  • Free cholesterol versus cholesterol ester ratio determination

  • Cholesterol efflux capacity assessment

• Inhibitor studies:

  • Dose-response inhibition curves

  • Reversibility testing

  • Selectivity profiling against related enzymes

This comprehensive analytical approach enables thorough characterization of SOAT1 function across experimental contexts .

What are the critical variables that can affect reproducibility in SOAT1 inhibition studies?

To ensure reproducibility in SOAT1 inhibition studies, researchers should carefully control:

• Experimental conditions:

  • Cell culture conditions (passage number, cell density, serum batch)

  • Inhibitor concentration and exposure time (48-hour treatment period was used in published studies)

  • Solvent concentration (DMSO can affect cellular physiology at high concentrations)

  • Assay timing and sample processing protocols

• Biological variables:

  • Cell type and source (primary cells versus cell lines)

  • Disease model characteristics (age, sex, genetic background)

  • Compensatory mechanisms (e.g., ABCA1 upregulation occurs in response to SOAT1 inhibition)

  • Context-dependent effects (SOAT1 inhibition had different effects in healthy versus disease states)

• Technical considerations:

  • Reagent quality and consistency

  • Instrument calibration and settings

  • Data normalization methods

  • Statistical analysis approaches (including appropriate corrections for multiple comparisons)

Careful documentation and control of these variables will enhance reproducibility and facilitate cross-laboratory validation of findings.

How might the role of SOAT1 differ across tissues and disease contexts?

While the search results primarily focused on kidney disease models, the data suggest tissue- and context-specific roles for SOAT1:

• Baseline versus disease states: SOAT1 deficiency alone did not affect renal cholesterol content or cause pathology in healthy mice, but provided significant protection in disease models. This suggests SOAT1's role becomes critical under pathological conditions .

• Tissue-specific effects: The mechanisms and consequences of SOAT1 inhibition may vary across tissues based on their specific cholesterol handling requirements. Research examining SOAT1 across multiple tissues in Macaca fascicularis would provide valuable comparative insights.

• Disease context variation: SOAT1 inhibition showed benefits in both diabetic kidney disease and Alport Syndrome models, but through potentially different mechanisms. This suggests the therapeutic value of SOAT1 inhibition may extend across multiple disease contexts .

• Species-specific considerations: While Macaca fascicularis SOAT1 shows significant homology to human SOAT1, subtle differences may exist in tissue expression patterns, regulatory mechanisms, or interaction partners that could affect translational relevance .

Future research should systematically compare SOAT1 function across tissues, disease models, and species to fully elucidate its context-dependent roles.

What research gaps remain in understanding SOAT1 biology across primate models?

Despite significant advances, several important knowledge gaps remain:

• Comparative SOAT1 function across primate species: Direct comparisons of SOAT1 enzymatic activity, regulation, and inhibitor sensitivity between Macaca fascicularis, other non-human primates, and humans would enhance translational understanding.

• Tissue expression atlas: Comprehensive mapping of SOAT1 expression patterns across tissues in Macaca fascicularis compared to humans would identify key similarities and differences.

• Post-translational regulation: The mechanisms controlling SOAT1 activity beyond transcriptional regulation, including potential post-translational modifications, protein-protein interactions, and subcellular localization, remain underexplored.

• Long-term consequences of SOAT1 inhibition: While acute and short-term studies show benefits, the long-term consequences of SOAT1 inhibition, particularly regarding compensatory mechanisms like ABCA1 upregulation, require further investigation .

• Genetic variants and disease susceptibility: The impact of SOAT1 genetic variations on disease susceptibility and progression in both Macaca fascicularis and humans represents an important area for future research.

Addressing these gaps will enhance our understanding of SOAT1 biology and its therapeutic potential across disease contexts.