Recombinant Macaca fascicularis Suppressor of tumorigenicity 7 protein (ST7)

Shipped with Ice Packs

In Stock

Cat. No.

BT2474780

Source

in vitro E.coli expression system

Synonyms

ST7; Suppressor of tumorigenicity 7 protein

Quick Inquiry

Product Specs

Form

Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.

Lead Time

Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.

Notes

Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.

Reconstitution

Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.

Shelf Life

Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.

Storage Condition

Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.

Tag Info

Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms

ST7; Suppressor of tumorigenicity 7 protein

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

1-534

Protein Length

full length protein

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Target Names

ST7

Target Protein Sequence

MFGTESSLSMFLNTLTPKFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSHLRP LLGGVDNNSSNNSNSSNGDSDSNRQSVSECKVWRNPLNLFRGAEYNRYTWVTGREPLTYY DMNLSAQDHQTFFTCDSDHLRPADAIMQKAWRERNPQARISAAHEALEINEIRSRVEVPL IASSTIWEIKLLPKCATAYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQ YEAQHRRDTNVLVYIKRRLAMCARRLGRTREAVKMMRDLMKEFPLLSMFNIHENLLEALL ELQAYADVQAVLAKYDDISLPKSATICYTAALLKARAVSDKFSPEAASRRGLSTAEMNAV EAIHRAVEFNPHVPKYLLEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLH CTWEGTFRMIPYPLEKGHLFYPYPICTETADRELLPSFHEVSVYPKKELPFFILFTAGLC SFTAMLALLTHQFPELMGVFAKAFLSTLFAPLNFVMEKVESILPSSLWHQLTRI

Uniprot No.

Q2PG42

Target Background

Database Links

KEGG: mcf:102124299

UniGene: Mfa.8546

Protein Families

ST7 family

Subcellular Location

Membrane; Multi-pass membrane protein.

Q&A

The following FAQs address key methodological considerations for researchers working with recombinant Macaca fascicularis Suppressor of Tumorigenicity 7 protein (ST7) in academic settings. Questions are categorized by complexity, with answers emphasizing experimental design, technical challenges, and data interpretation.

Advanced Research Questions

How to design functional assays validating ST7’s tumor suppressor activity in primate models?

In vitro:
- Transfect ST7 into Macaca fascicularis cell lines (e.g., haploid embryonic stem cells ) and assess proliferation via BrdU incorporation.
- Perform RNA-seq to identify downstream targets (e.g., apoptosis regulators).
In vivo: Use xenograft models in immunocompromised mice, injecting ST7-expressing Macaca cells and monitoring tumor growth kinetics.

What computational and structural methods resolve discrepancies in ST7’s mechanistic data across studies?

Approach:
- Use AlphaFold2 to predict ST7’s 3D structure and compare with experimental data (e.g., cryo-EM).
- Analyze evolutionary conservation of functional domains across primates using resources like NCBI Gene .
Case study: Bat ST7’s N-terminal domain (1-585aa) shares 78% homology with Macaca fascicularis, suggesting conserved tumor-suppressive regions .

How to address conflicting results in ST7’s role across cancer types?

Methodological adjustments:
- Contextualize cell-type specificity by profiling ST7 expression in Macaca tissue lysates (e.g., ’s human cell lysate protocol).
- Use CRISPR/Cas9 knockouts in isogenic cell lines to isolate ST7’s effects.

Comparative Data Table: ST7 Expression Systems

Parameter	E. coli	Mammalian Systems
Yield	0.1–1.0 mg/mL	0.01–0.1 mg/mL
Post-translational Modifications	None	Phosphorylation, glycosylation
Typical Purity	>90% (SDS-PAGE)	70–85% (HPLC)
Functional Assay Compatibility	In vitro binding	In vivo tumor models

Key Research Findings

Genetic Stability: Macaca fascicularis haploid embryonic stem cells maintain genomic integrity for >140 days, enabling long-term ST7 functional studies .
Structural Insights: Bat ST7’s C-terminal domain (residues 400-585) is critical for binding tumorigenic kinases, a feature likely conserved in primates .
Evolutionary Analysis: ST7 in Macaca shows 94% amino acid identity with human ST7, but regulatory regions differ, impacting expression levels in cancer models .

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Macaca fascicularis Suppressor of tumorigenicity 7 protein (ST7)

Product Specs

Target Background

Q&A

Advanced Research Questions

How to design functional assays validating ST7’s tumor suppressor activity in primate models?

What computational and structural methods resolve discrepancies in ST7’s mechanistic data across studies?

How to address conflicting results in ST7’s role across cancer types?

Comparative Data Table: ST7 Expression Systems

Key Research Findings

Quick Inquiry

Category

Service