Recombinant Macaca fascicularis Transmembrane protein 35 (TMEM35)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Neurobiology

TMEM35 (NACHO) is essential for the assembly and trafficking of neuronal nAChRs, particularly the α7 subtype. Key findings include:

RoleMechanismStudy Findings
α7 nAChR ChaperoneFacilitates receptor oligomerization and membrane localizationtmem35a-knockout (KO) mice show complete loss of α7 nAChR surface expression .
Pain ModulationRegulates spinal cord α7 nAChR-dependent nociceptiontmem35a KO mice exhibit thermal hyperalgesia (enhanced heat sensitivity) and mechanical allodynia (pain from non-painful stimuli) .
NeuroinflammationModulates spinal cord microglial activityIncreased microglial density in tmem35a KO mice correlates with hyperalgesia .

Applications in Research

Recombinant TMEM35 is utilized in:

ApplicationMethodPurpose
SDS-PAGEDenaturing electrophoresisPurity verification and molecular weight confirmation .
ELISAEnzyme-linked immunosorbent assayQuantification of TMEM35 in biological samples or detection in binding assays .
Functional StudiesReconstitution with nAChR subunits in vitroInvestigating chaperone-dependent receptor assembly .

Key Research Findings

A landmark study in tmem35a KO mice revealed:

  1. Pain Phenotypes:

    • Thermal Hyperalgesia: Reduced latency to withdrawal from noxious heat (e.g., 55°C).

    • Mechanical Allodynia: Pain response to light touch (e.g., 0.07–0.60 g von Frey filaments) .

  2. Mechanistic Insights:

    • α7 nAChR-mediated analgesia is abolished in KO mice, highlighting its role in pain modulation.

    • Spinal cord transcriptomics identified 72 differentially expressed genes (DEGs) linked to neuroinflammation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specified tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TMEM35A; NACHO; TMEM35; QnpA-14372; Novel acetylcholine receptor chaperone; Transmembrane protein 35A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
TMEM35A
Target Protein Sequence
MASPRTVTIVALSVALGLFFVFMGTIKLTPRLSKDAYSEMKRAYKSYVRALPLLKKMGIN SILLRKSIGALEVACGIVMTLVPGRPKDVANFFLLLLVLAVLFFHQLVGDPLKRYAHALV FGILLTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS
Uniprot No.

Target Background

Function
Transmembrane protein 35 (TMEM35) is a molecular chaperone that plays a crucial role in the proper assembly and functional expression of nicotinic acetylcholine receptors (nAChRs) throughout the brain. It is essential for the correct folding, assembly, function, and surface trafficking of alpha-7 (CHRNA7), alpha-4-beta-2, alpha-3-beta-2, and alpha-3-beta-4 receptors. TMEM35 forms stable associations with ribophorin-1 (RPN1) and ribophorin-2 (RPN2), components of the oligosaccharyl transferase (OST) complex, as well as with calnexin (CANX). These interactions are critical for NACHO-mediated effects on CHRNA7 assembly and function. TMEM35 facilitates the proper folding and assembly of alpha-6-beta-2 and alpha-6-beta-2-beta-3 receptors, acting at early stages of the nAChRs subunit assembly. It also promotes the expression of the alpha-4(2):beta-2(3) stoichiometric form over the alpha-4(3):beta-2(2) form.
Database Links

KEGG: mcf:101926690

UniGene: Mfa.1599

Protein Families
DoxX family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein. Cytoplasmic vesicle. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

How does TMEM35 differ from TMEM35B?

While both are transmembrane proteins, TMEM35 (TMEM35A) and TMEM35B represent distinct proteins with different functions. TMEM35A functions primarily in neuroendocrine and memory processes , whereas TMEM35B has been implicated in pathological processes such as glioma progression . Their expression patterns also differ, with TMEM35B protein mainly expressed in the nucleus rather than membrane compartments . When designing experiments, researchers should be careful not to conflate these two proteins despite their similar nomenclature.

What expression systems are recommended for producing recombinant M. fascicularis TMEM35?

  • Prokaryotic systems (E. coli): Suitable for structural studies and antibody production but may lack post-translational modifications

  • Eukaryotic systems:

    • Insect cells (Sf9, High Five): Better for membrane proteins with complex folding

    • Mammalian cells (HEK293, CHO): Optimal for functional studies requiring native-like post-translational modifications

When using E. coli, optimizing codons for bacterial expression and employing specialized strains for membrane proteins (e.g., C41/C43) may improve yield and quality.

What are the recommended reconstitution and storage protocols for recombinant TMEM35?

For optimal stability and activity of recombinant M. fascicularis TMEM35:

  • Reconstitution:

    • Briefly centrifuge the vial prior to opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% recommended)

  • Storage:

    • Store lyophilized powder at -20°C/-80°C upon receipt

    • After reconstitution, aliquot to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

    • Long-term storage requires -20°C/-80°C in Tris/PBS-based buffer with 6% trehalose (pH 8.0)

What methodological approaches are effective for studying TMEM35 function in neural tissue?

Based on research methodologies used in related systems, several approaches are recommended:

MethodologyApplicationAdvantagesLimitations
Knockout modelsFunctional analysisReveals systemic rolesPotential compensatory mechanisms
RNA interferenceAcute knockdownTemporal controlOff-target effects
ElectrophysiologySynaptic functionDirect measurement of activityTechnical complexity
Proteomic analysisInteractome identificationComprehensive protein networksRequires specialized equipment
ImmunohistochemistryLocalization studiesTissue-specific expression patternsAntibody specificity issues

Knockout studies have been particularly informative, revealing TMEM35's role in HPA axis function, anxiety-related behaviors, and hippocampus-dependent memory consolidation through effects on synaptic plasticity and postsynaptic protein composition .

How can genomic resources for M. fascicularis enhance TMEM35 research?

Recent advances in M. fascicularis genomics provide significant research opportunities:

  • High-quality genome assembly: A phased hybrid genomic assembly with chromosome-length scaffolds is now available (European Nucleotide Archive Accession: GCA_902985625) . This resource enables:

    • Precise genetic manipulation strategies

    • Identification of regulatory elements controlling TMEM35 expression

    • Comparative genomic analyses across primate species

  • Methodological applications:

    • CRISPR/Cas9 target design with reduced off-target effects

    • Identification of splice variants and isoforms

    • Phylogenetic analysis of TMEM35 evolution in primates

The genomic context of TMEM35 can reveal species-specific regulatory mechanisms that may be relevant when translating findings between model systems .

What are the current challenges in correlating TMEM35 function between rodent models and primate systems?

Several methodological and biological considerations challenge cross-species translation:

  • Evolutionary divergence: Despite high conservation, subtle structural differences may affect protein-protein interactions and signaling pathways

  • Experimental limitations:

    • Genetic manipulation is more established in mice than primates

    • Direct functional assays (e.g., electrophysiology) in primate brain tissue are technically challenging

  • Neuroanatomical differences: While basic HPA axis and limbic circuitry are conserved, important species differences exist in connectivity and cytoarchitecture

  • Methodological approaches:

    • Comparative protein-protein interaction studies using co-immunoprecipitation

    • Multi-species phosphoproteomics to identify conserved signaling pathways

    • Cross-species cellular models (e.g., iPSC-derived neurons) to compare function in consistent cellular contexts

How can proteomic approaches identify TMEM35-dependent synaptic changes?

Based on findings from TMEM35 knockout models, quantitative proteomics offers powerful insights:

  • Recommended methodology:

    • Synaptosomal fractionation to isolate synaptic compartments

    • Stable isotope labeling (SILAC or TMT) for quantitative comparison

    • Phosphoproteomics to identify changes in signaling pathways

  • Critical targets:

    • Postsynaptic density proteins (PSD95 was reduced in knockout models)

    • N-methyl-d-aspartate receptors (NMDARs)

    • Proteins involved in long-term potentiation pathways

  • Data analysis approach:

    • Pathway analysis (e.g., Ingenuity Pathway Analysis) to identify molecular networks

    • Correlation with electrophysiological phenotypes

    • Integration with transcriptomic data to identify regulatory mechanisms

What is the significance of TMEM35 in stress-related neurobehavioral research?

TMEM35 knockout studies reveal critical involvement in stress biology:

  • Phenotypic effects:

    • Elevated basal corticosterone levels despite normal stress-induced responses

    • Increased anxiety-like behavior

    • Impaired hippocampus-dependent fear and spatial memories

  • Research applications:

    • Model for studying mechanisms of anxiety disorders

    • Investigation of memory consolidation pathways

    • HPA axis regulation and dysregulation

  • Methodological considerations:

    • Behavioral testing batteries should include both anxiety and memory assessments

    • Corticosterone measurements should include both basal and stress-induced timepoints

    • Molecular analyses should examine both transcriptional and post-translational regulation

How does TMEM35 research contribute to understanding neurodegenerative processes?

While direct evidence from provided sources is limited, TMEM35's role in synaptic plasticity suggests research directions for neurodegenerative studies:

  • Synaptic dysfunction: TMEM35 knockout leads to loss of long-term potentiation and reduced levels of proteins critical for synaptic plasticity (PSD95, NMDARs) , which are also implicated in neurodegenerative conditions

  • Research approaches:

    • Investigation of TMEM35 expression changes in neurodegenerative disease models

    • Assessment of TMEM35-dependent neuroprotective mechanisms

    • Screening of compounds that modulate TMEM35 function as potential therapeutic targets

  • Methodological integration:

    • Combine electrophysiology with molecular analyses

    • Longitudinal studies in aging models

    • Cross-species validation of findings

What are the methodological considerations for using TMEM35 as a research tool in oncology studies?

While TMEM35B (not TMEM35/TMEM35A) has been implicated in glioma biology , researchers should consider:

  • Differential diagnostic potential:

    • TMEM35B expression distinguishes between normal tissue and gliomas

    • Expression correlates with tumor stage (higher in stage III+IV than I+II)

    • High diagnostic value based on ROC curve analysis (AUC values)

  • Functional assessment methods:

    • siRNA or shRNA knockdown to assess proliferation effects

    • Migration and invasion assays (e.g., Transwell)

    • Analysis of downstream molecular pathways

  • Experimental controls:

    • Clear distinction between TMEM35 (TMEM35A) and TMEM35B

    • Appropriate normal tissue controls

    • Validation across multiple cell lines or primary samples

What are common issues in recombinant TMEM35 expression and purification?

When working with recombinant M. fascicularis TMEM35:

  • Expression challenges:

    • As a transmembrane protein, TMEM35 may form inclusion bodies in E. coli

    • Protein folding may require specialized conditions

    • Low yield due to toxicity to host cells

  • Purification considerations:

    • His-tag accessibility may be limited by protein folding

    • Detergent selection critical for maintaining native conformation

    • Buffer optimization to maintain stability

  • Quality control methods:

    • SDS-PAGE to confirm >90% purity

    • Western blotting with anti-His and anti-TMEM35 antibodies

    • Mass spectrometry to confirm protein identity

    • Functional assays appropriate to research questions

How can researchers validate antibodies for TMEM35 detection in M. fascicularis tissues?

Antibody validation is critical for reliable TMEM35 detection:

  • Validation methodology:

    • Western blotting against recombinant protein and tissue lysates

    • Immunohistochemistry with peptide competition controls

    • Comparison of multiple antibodies targeting different epitopes

    • Knockout/knockdown controls where available

  • Cross-reactivity considerations:

    • Sequence alignment between human, macaque, and mouse TMEM35

    • Epitope conservation analysis

    • Testing in multiple species when possible

  • Application-specific validation:

    • For immunohistochemistry: fixation protocol optimization

    • For immunoprecipitation: binding capacity assessment

    • For flow cytometry: cell permeabilization optimization

What analytical methods are recommended for measuring TMEM35 expression levels in experimental systems?

For quantitative analysis of TMEM35 expression:

  • mRNA quantification:

    • RT-qPCR with validated primers specific to M. fascicularis TMEM35

    • RNA-Seq for transcriptome-wide context

    • In situ hybridization for spatial distribution

  • Protein quantification:

    • Western blotting with appropriate loading controls

    • Immunohistochemistry with standardized scoring systems

    • ELISA development for high-throughput analysis

  • Data analysis approaches:

    • Normalization to housekeeping genes/proteins

    • Statistical methods appropriate for data distribution

    • Consideration of biological vs. technical replicates

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.