Recombinant Macaca fascicularis Transmembrane protein 55B (TMEM55B)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PIP4P1; TMEM55B; QtsA-17009; Type 1 phosphatidylinositol 4,5-bisphosphate 4-phosphatase; Type 1 PtdIns-4,5-P2 4-Ptase; PtdIns-4,5-P2 4-Ptase I; Transmembrane protein 55B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-284
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
Target Protein Sequence
MAADGERSPLLSEPIDGGAGGNGLVGPGGSGAGPGGGLTPSAPPYGAGKHAPPQAFPPFP EGHPAVLPGEDPPPYSPLTSPDSGSAPMITCRVCQSLINVEGKMHQHVVKCGVCNEATPI KNAPPGKKYVRCPCNCLLICKVTSQRIACPRPYCKRIINLGPVHPGPLSPEPQPMGVRVI CGHCKNTFLWTEFTDRTLARCPHCRKVSSIGRRYPRKRCICCFLLGLLLAVTATGLAFGT WKHARRYGGIYAAWAFVILLAVLCLGRALYWACMKVSHPVQNFS
Uniprot No.

Target Background

Function
This recombinant Macaca fascicularis Transmembrane protein 55B (TMEM55B) catalyzes the hydrolysis of phosphatidylinositol-4,5-bisphosphate (PtdIns-4,5-P2) to phosphatidylinositol-4-phosphate (PtdIns-4-P). It does not hydrolyze phosphatidylinositol 3,4,5-trisphosphate, phosphatidylinositol 3,4-bisphosphate, inositol 3,5-bisphosphate, inositol 3,4-bisphosphate, phosphatidylinositol 5-monophosphate, phosphatidylinositol 4-monophosphate, or phosphatidylinositol 3-monophosphate. TMEM55B regulates lysosomal positioning by recruiting JIP4 to lysosomal membranes, thus inducing retrograde transport of lysosomes along microtubules. It contributes to the assembly of the V-ATPase complex in lysosomal membrane lipid rafts and subsequent amino acid-dependent activation of mTORC1. TMEM55B may also play a role in regulating cellular cholesterol metabolism.
Database Links

KEGG: mcf:101866619

UniGene: Mfa.7037

Subcellular Location
Late endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Cytoplasmic vesicle, phagosome membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

What is TMEM55B and what are its key structural features?

TMEM55B is a lysosomal transmembrane protein composed of 284 amino acid residues with two transmembrane domains. Its N- and C-terminal domains face the cytosol, making them accessible for protein-protein interactions . The protein contains a highly conserved region spanning residues 80-160, termed the TMEM55-conserved domain, which adopts a globular fold with a hydrophobic groove along one surface aligned with conserved residues . This domain is critical for interaction with other proteins, particularly RILPL1.

The protein also contains specific motifs including:

  • PPXY motif that mediates interaction with NEDD4-like E3 ubiquitin ligases

  • PSAP motif that facilitates interaction with components of the ESCRT complex for lysosomal repair

  • Multiple ubiquitination sites (K96, K103, K114, K120, K121, K134, and K148) located in the conserved domain

What cellular functions has TMEM55B been implicated in?

TMEM55B participates in multiple critical cellular processes:

FunctionDescriptionReference
Lysosomal positioningBinds to dynein adapter JIP4 to promote dynein-dynactin-dependent lysosomal trafficking to the perinuclear region
mTORC1 activationContributes to amino acid-induced mTORC1 activation by interacting with V-ATPase and Ragulator complexes at the lysosomal membrane
Autophagy regulationMediates NEDD4-dependent PLEKHM1 ubiquitination, causing PLEKHM1 proteasomal degradation and halting autophagosome/lysosome fusion
Lysosomal repairPromotes recruitment of ESCRT machinery to lysosomal membranes to stimulate repair mechanisms
Stress responseSequesters the FLCN/FNIP complex to facilitate TFE3 translocation to the nucleus, enabling stress adaptation transcriptional programs
Lipid metabolismModulates lipophagy and mitophagy, with deficiency enhancing lipophagy while impairing mitophagy

How is TMEM55B expression regulated in response to cellular stress?

TMEM55B functions as a molecular sensor that coordinates cellular responses to oxidative stress. When cells experience oxidative stress (e.g., exposure to arsenite/NaAsO₂), TMEM55B undergoes increased ubiquitination mediated by NEDD4-like E3 ligases . This post-translational modification is dependent on TMEM55B's PPXY motif, as mutation of this motif (P66A) prevents stress-induced ubiquitination .

The regulation involves:

  • Increased interaction with NEDD4-like E3 ligases specifically during oxidative stress

  • Ubiquitination at multiple lysine residues (K96, K103, K114, K120, K121, K134, and K148)

  • Subsequent activation of downstream pathways for halting autophagosome-lysosome fusion and promoting lysosomal repair

Importantly, knockout of TMEM55B genes in zebrafish embryos increases susceptibility to oxidative stress, resulting in early death upon arsenite toxicity, highlighting the protein's essential role in stress resilience .

What is the relationship between TMEM55B and LRRK2 signaling pathways?

TMEM55B interacts with the LRRK2 signaling pathway through its association with RILPL1. This interaction is dependent on LRRK2 kinase activity . Research indicates that:

  • TMEM55B co-immunoprecipitates with wild-type RILPL1 when co-expressed with LRRK2[Y1699C], but not with mutant RILPL1[R293A]

  • Treatment with MLi-2 (LRRK2 inhibitor) or introduction of a kinase-dead mutation (D2017A) markedly inhibits association of RILPL1 with TMEM55B

  • The C-terminal 8 amino acids of RILPL1 are essential for binding to TMEM55B, and mutation of several residues within this TMEM-Binding motif (Glu394Lys, Glu398Lys, and Ala399Leu) suppresses interaction

  • Neither RILP nor RILPL2 co-immunoprecipitate with TMEM55B, consistent with the lack of conservation of the TMEM55-Binding motif in these proteins

LRRK2 activity promotes co-localization of RILPL1 and TMEM55B at lysosomes, with confocal microscopy showing that endogenous pRab10, overexpressed Myc-RILPL1, and endogenous TMEM55B co-localize in the perinuclear region . This co-localization is reduced with MLi-2 treatment but not significantly affected by nocodazole treatment .

How does TMEM55B contribute to the V-ATPase assembly and subsequent mTORC1 activation?

TMEM55B plays a crucial role in the assembly of the vacuolar-type proton ATPase (V-ATPase) complex in lipid rafts of the lysosomal membrane, which is essential for mTORC1 activation .

The mechanistic process involves:

  • TMEM55B interacts with components of the V-ATPase and Ragulator complexes at the lysosomal membrane

  • This interaction facilitates the recruitment of the V1 domain subcomplex of V-ATPase to lipid rafts

  • Proper assembly of the V-ATPase complex enables amino acid-induced mTORC1 activation

  • In TMEM55B-depleted cells, amino acid-induced phosphorylation of mTORC1 substrates S6K and 4E-BP is attenuated

  • TMEM55B depletion also evokes lysosomal stress, as evidenced by translocation of the transcription factor TFEB to the nucleus

This suggests a model where TMEM55B acts as a scaffold protein that coordinates the assembly of the V-ATPase complex, which is necessary for amino acid sensing and subsequent mTORC1 activation.

What is the role of TMEM55B in lipophagy and mitophagy, and how does it impact metabolic disease?

TMEM55B deficiency creates an imbalance between lipophagy and mitophagy that can accelerate metabolic dysfunction-associated steatotic liver disease (MASLD) .

The dual effect involves:

  • Enhanced lipophagy: TMEM55B deficiency increases lipophagy, leading to increased fatty acid release from lysosomes to mitochondria

  • Impaired mitophagy: Simultaneously, TMEM55B deficiency impairs mitophagy, causing an accumulation of dysfunctional mitochondria

  • Metabolic consequences: This imbalance leads to increased lipid accumulation and oxidative stress, worsening MASLD

  • Lysosomal positioning effects: Inhibition of TMEM55B in hepatoma cell lines leads to perinuclear localization of lysosomes, which appear both enlarged and immobile

Research in murine models demonstrates that inhibition of TMEM55B accelerates MASLD onset and progression, suggesting that TMEM55B's role in maintaining the balance between lipophagy and mitophagy is crucial for metabolic homeostasis .

What expression systems and purification strategies are most effective for producing recombinant TMEM55B?

Based on commercial protein information, several expression systems have been successfully used for recombinant TMEM55B production:

Expression SystemAdvantagesConsiderationsReference
E. coliCost-effective, high yield, simple culture conditionsMay lack appropriate post-translational modifications, potential folding issues for transmembrane proteins
YeastBetter protein folding than E. coli, some post-translational modificationsMore complex culture conditions, moderate yield
BaculovirusExcellent for mammalian transmembrane proteins, appropriate post-translational modificationsMore expensive, longer production time, specialized expertise required
Mammalian CellMost native-like post-translational modifications and foldingHighest cost, lower yield, complex media requirements

For purification of recombinant TMEM55B, the following approaches are recommended:

  • Use of affinity tags (His-tag, GST-tag) for initial capture

  • Size exclusion chromatography to remove aggregates and improve homogeneity

  • Ion exchange chromatography for further purification if needed

  • Quality control by SDS-PAGE to confirm purity (≥85-90% purity is achievable)

What methodologies are recommended for studying TMEM55B's role in lysosomal repair and autophagy regulation?

To investigate TMEM55B's functions in lysosomal repair and autophagy regulation, researchers should consider the following methodologies:

  • TMEM55B ubiquitination analysis:

    • Express TMEM55B-WT or TMEM55B-P66A with HA-tagged ubiquitin

    • Immunoprecipitate under denaturing conditions

    • Immunoblot for ubiquitin to detect high molecular weight smears indicating ubiquitination

    • For detailed analysis, perform trypsin digestion followed by purification of ubiquitinated peptides with anti-diGly antibodies and MS identification

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to detect interactions with NEDD4-like E3 ligases, ESCRT components, and the FLCN/FNIP complex

    • Assess interactions under various stress conditions (e.g., starvation, oxidative stress)

    • Use mutants (e.g., TMEM55B-P66A) to validate specific binding motifs

  • Lysosomal repair assessment:

    • Induce lysosomal damage with appropriate stressors

    • Monitor recruitment of ESCRT machinery components

    • Assess lysosomal integrity using pH-sensitive dyes or leakage of lysosomal enzymes

    • Compare repair efficiency between wild-type and TMEM55B-deficient cells

  • Autophagy flux analysis:

    • Monitor LC3-II/I ratio with and without lysosomal inhibitors

    • Assess autophagosome-lysosome fusion using fluorescently tagged markers

    • Quantify PLEKHM1 ubiquitination and degradation under oxidative stress conditions

What imaging techniques are most suitable for studying TMEM55B localization and its effects on lysosomal positioning?

Several advanced imaging approaches have been validated for studying TMEM55B:

  • Confocal microscopy:

    • Used to investigate co-localization of endogenous pRab10, overexpressed Myc-RILPL1, and endogenous TMEM55B in the perinuclear region

    • Allows assessment of how treatments (e.g., MLi-2, nocodazole) affect co-localization patterns

  • Expansion microscopy:

    • Provides enhanced resolution for detailed visualization of lysosomes

    • Reveals the percentage of lysosomes (determined by endogenous TMEM55B expression) that co-localize with other proteins like Myc-RILPL1

    • Allows detection of subtle changes in co-localization upon treatment with inhibitors

  • Live-cell imaging:

    • Essential for tracking lysosomal positioning dynamics in response to various stimuli

    • Can be used to observe the effects of TMEM55B inhibition on lysosomal mobility and distribution

  • Fluorescence recovery after photobleaching (FRAP):

    • Useful for assessing protein dynamics at lysosomes

    • Can determine whether TMEM55B affects the mobility and recruitment kinetics of interaction partners

How should researchers interpret contradictory findings regarding TMEM55B's phosphatase activity?

The phosphatase activity of TMEM55B has been a subject of conflicting reports. When encountering contradictory findings, researchers should consider:

  • Recombinant protein quality: A recent study reported that recombinant TMEM55B lacked detectable inositol phosphatase activity when expressed in certain systems . This may be due to:

    • Improper folding of the recombinant protein

    • Missing post-translational modifications

    • Absence of necessary cofactors or binding partners

    • Suboptimal assay conditions

  • Context-dependent activity: TMEM55B's enzymatic activity may be:

    • Substrate-specific (limited to certain phosphoinositides)

    • Regulated by specific cellular conditions or stressors

    • Dependent on protein-protein interactions that activate the enzyme

    • Influenced by subcellular localization

  • Recommended approach to resolve contradictions:

    • Test multiple recombinant protein preparation methods

    • Assess activity in cell-free systems and in cellular contexts

    • Compare activity between wild-type and mutant proteins

    • Validate findings using complementary approaches (e.g., genetic manipulation and pharmacological inhibition)

What controls are essential when studying the effects of TMEM55B on cellular processes?

To ensure robust and reproducible results when studying TMEM55B, the following controls are essential:

  • For protein interaction studies:

    • Use TMEM55B mutants (e.g., P66A) to validate specificity of NEDD4-like E3 ligase interactions

    • Include both untreated and stress-induced conditions to detect condition-specific interactions

    • Perform reciprocal co-immunoprecipitations where possible

    • Include negative controls (e.g., RILP and RILPL2 that lack the TMEM55-Binding motif)

  • For ubiquitination studies:

    • Compare TMEM55B-WT with PPXY motif mutants (TMEM55B-P66A)

    • Include denaturing conditions during immunoprecipitation to eliminate non-covalent interactions

    • Use proteasome inhibitors to stabilize ubiquitinated proteins

  • For functional studies:

    • Use multiple TMEM55B knockdown/knockout strategies to rule out off-target effects

    • Perform rescue experiments with wild-type and mutant TMEM55B

    • Include pharmacological controls (e.g., MLi-2 for LRRK2 inhibition)

    • Compare effects across multiple cell types to assess generalizability

  • For stress response studies:

    • Include time-course experiments to capture transient responses

    • Test multiple stressors to determine specificity (e.g., NaAsO₂, starvation)

    • Validate in animal models (e.g., zebrafish) to confirm physiological relevance

What are the most promising therapeutic applications of targeting TMEM55B?

Given TMEM55B's roles in critical cellular processes, several therapeutic directions warrant investigation:

  • Metabolic disease interventions:

    • Since TMEM55B deficiency accelerates MASLD onset and progression in murine models , enhancing TMEM55B function might represent a therapeutic strategy

    • Targeting the balance between lipophagy and mitophagy mediated by TMEM55B could help address metabolic disorders

  • Oxidative stress protection:

    • TMEM55B's role as a molecular sensor coordinating responses to oxidative stress makes it a potential target for neuroprotective strategies

    • Enhancing TMEM55B-mediated lysosomal repair mechanisms could protect against oxidative damage in neurodegenerative diseases

  • Lysosomal storage disorders:

    • TMEM55B's involvement in lysosomal homeostasis suggests potential applications in lysosomal storage disorders

    • Modulating TMEM55B activity might improve lysosomal function and positioning in these conditions

What methodological innovations are needed to better understand TMEM55B function?

Despite significant progress, several methodological challenges remain in TMEM55B research:

  • Improved structural biology approaches:

    • While AlphaFold predictions have provided insights into TMEM55B structure , experimental structural determination (X-ray crystallography, cryo-EM) of TMEM55B alone and in complex with interaction partners would significantly advance the field

  • Dynamic interaction mapping:

    • Development of techniques to map the temporally regulated interactome of TMEM55B under various stress conditions

    • Proximity labeling approaches (BioID, APEX) optimized for lysosomal membrane proteins

  • Tissue-specific knockout models:

    • Generation of conditional TMEM55B knockout animals to study tissue-specific functions without developmental compensation

    • Humanized mouse models expressing human TMEM55B variants

  • High-throughput screening platforms:

    • Development of assays to identify small molecules that modulate TMEM55B activity or its interactions

    • Phenotypic screens to identify genetic modifiers of TMEM55B-dependent processes

By addressing these methodological challenges, researchers will gain deeper insights into TMEM55B biology and potentially unlock new therapeutic approaches for diseases involving lysosomal dysfunction, oxidative stress, and metabolic disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.