Recombinant Macaca fascicularis Ubiquitin-associated domain-containing protein 2 (UBAC2)

Shipped with Ice Packs
In Stock

Description

Function

UBAC2 is involved in several cellular processes:

  • ER-phagy receptor UBAC2 serves as an ER-phagy receptor that can suppress the unfolded protein response and sterile inflammation .

  • Wnt Signaling Pathway Regulation UBAC2, along with LMBR1L and AMFR, participates in the degradation of CTNNB1 and Wnt receptors, thereby negatively regulating the Wnt signaling pathway .

  • FAF2 Trafficking Restriction UBAC2 restricts the movement of FAF2 from the endoplasmic reticulum to lipid droplets .

Structure and Location

UBAC2 contains a ubiquitin-associated domain . It is located in the endoplasmic reticulum membrane as a multi-pass membrane protein.

Role in Disease

Research suggests that UBAC2 is associated with diseases such as Behcet's disease and hepatocellular carcinoma:

  • Behcet's Disease A study involving Han Chinese and Turkish cohorts identified a consistent association between UBAC2 and Behcet's disease. Certain single nucleotide polymorphisms (SNPs) within the UBAC2 gene were found to be associated with the disease .

    • Table 1 shows the sample sizes, mean ages, and sex distribution in the case and control groups :

      Table 1.

      AnalysisSamples size (Case)Mean age (S.D) (Case)Male/Female (Case)Samples size (Control)Mean age (S.D) (Control)Male/Female (Control)
      Stage I14732.90 ± 7.50129/1895139.77 ± 9.99712/239
      Stage II33033.39 ± 7.98268/6238334.61 ± 7.85301/82
      Combined47733.07 ± 7.64397/80133437.07 ± 9.111,013/321
      SD, standard deviation
  • Hepatocellular Carcinoma (HCC) UBAC2-like protein (UBAP2L) has been found to promote the growth and metastasis of HCC. Knocking down UBAP2L expression significantly inhibited HCC growth and metastasis in experiments, potentially by regulating the PI3K/AKT and P53 signaling pathways .

Role in ER Stress and ER-phagy

UBAC2 is involved in ER-phagy, a selective type of autophagy that degrades portions of the endoplasmic reticulum (ER) . It functions as a receptor for ER-phagy, suppressing the unfolded protein response and sterile inflammation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
UBAC2; PHGDHL1; QtsA-10993; Ubiquitin-associated domain-containing protein 2; UBA domain-containing protein 2; Phosphoglycerate dehydrogenase-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-345
Protein Length
Full Length of Mature Protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
UBAC2
Target Protein Sequence
HCQKLFVYDLHAVKNDFQIWRLICGRIICLDLKDTFCSSLLIYNFRIFERRYGSRKFASF LLGSWVLSALFDFLLVEAMQYFFGITAASNLPSGFLAPVFALFVPFYCSIPRVQVAQILG PLSITNKTLIYILGLQLFTSGSYIWIVAISGLMSGLCYNSKMFQVHQVLCIPSWMAKFFS WTLEPIFSSSEPTSEARIGMGATLDIQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINW NRLFPPLRQRQNVNYQGGRQSEPAAPPPLEVSEEQVARLMEMGFSRGDALEALRASNNDL NVATNFLLQH
Uniprot No.

Target Background

Function
UBAC2 restricts the trafficking of FAF2 from the endoplasmic reticulum to lipid droplets. In conjunction with LMBR1L and the E3 ubiquitin-protein ligase AMFR, it negatively regulates the canonical Wnt signaling pathway in lymphocytes by promoting the ubiquitin-mediated degradation of CTNNB1 and Wnt receptors FZD6 and LRP6.
Database Links

KEGG: mcf:101866026

UniGene: Mfa.9009

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is UBAC2 and what is its role in cellular function?

UBAC2 (Ubiquitin-associated domain-containing protein 2) is an ER-resident protein containing three transmembrane domains that functions as an ER-phagy receptor. It plays a crucial role in maintaining ER homeostasis by facilitating the selective degradation of ER components through autophagy. UBAC2 undergoes autophagic degradation under conditions of starvation or ER stress, indicating its role in cellular stress responses . Its primary function involves balancing ER-phagy and inflammatory responses to maintain optimal immunity. UBAC2 deficiency disrupts ER homeostasis, resulting in enhanced inflammatory responses and increased susceptibility to inflammatory conditions .

What are the key structural features of Macaca fascicularis UBAC2?

Macaca fascicularis UBAC2 contains a highly conserved LIR (LC3-interacting region) motif that enables interaction with GABARAP (GABA type A receptor-associated protein), a key component of the autophagy machinery . The protein contains three transmembrane domains that anchor it to the ER membrane, allowing it to function in ER-phagy. Additionally, UBAC2 contains specific phosphorylation sites, notably serine 223, which is phosphorylated by MARK2 (microtubule affinity-regulating kinase 2) under ER stress conditions . This phosphorylation promotes UBAC2 dimerization, enhancing its association with GABARAP and accelerating ER-phagy.

How does UBAC2 participate in the autophagy pathway?

UBAC2 functions within the canonical autophagy pathway. Under starvation conditions, UBAC2 exhibits increased co-localization with autophagy markers WIPI2 and ATG16L1 at puncta sites, indicating its recruitment to nascent autophagosomal structures . Furthermore, autophagy activation promotes the distribution of UBAC2 into LAMP1-positive compartments (lysosomes), demonstrating its trafficking through the complete autophagic pathway . Coimmunoprecipitation and immunoblot analyses confirm that interactions between UBAC2 and key autophagy components (WIPI2, ATG16L1, LAMP1) increase under starvation-induced autophagy, verifying UBAC2's participation in this degradative pathway.

What genetic associations exist for UBAC2 in disease models?

UBAC2 has been identified as a risk allele for several inflammatory and autoimmune conditions. Most notably, enhanced UBAC2 expression is associated with the progression of Behcet's disease, an inflammatory disorder characterized by recurrent oral and genital ulcers, ocular inflammation, and skin lesions . Additionally, UBAC2 has been highly correlated with the development of malignant tumors (including skin and bladder cancers) and inflammatory bowel diseases . Genetic variants of UBAC2 have also been linked to non-melanoma skin cancer and Alzheimer's disease, suggesting its broad implications in inflammation-related pathologies .

What mechanisms regulate UBAC2-mediated ER-phagy?

UBAC2-mediated ER-phagy is regulated through a phosphorylation-dependent mechanism. Upon ER stress, MARK2 phosphorylates UBAC2 at serine 223, promoting UBAC2 dimerization . This dimerization significantly enhances the association between UBAC2 and GABARAP, thereby accelerating ER-phagy progression. The process depends on UBAC2's LIR motif, which directly interacts with GABARAP. Mutations in this LIR motif abolish the interaction and prevent UBAC2-mediated ER-phagy, indicating the critical nature of this domain . Additionally, UBAC2-mediated ER-phagy operates independently of other known ER-phagy receptors such as FAM134B, ATL3, SEC62, RTN3, CCPG1, and TEX264, suggesting UBAC2 functions through a distinct pathway .

How does UBAC2 modulate inflammatory responses?

UBAC2 suppresses inflammatory responses by maintaining ER homeostasis through its ER-phagy function. Experimental evidence demonstrates that UBAC2 knockout results in increased production of pro-inflammatory cytokines, including IL-6, TNFα, and IL-1β . At the molecular level, UBAC2 deficiency enhances the expression of ER stress markers upon treatment with stress inducers like tunicamycin (TM) or thapsigargin (TG) . Additionally, UBAC2 knockout increases NF-κB signaling pathway activation, as evidenced by enhanced phosphorylation of p65, a key component of the NF-κB complex . UBAC2 also regulates interferon-stimulated gene (ISG) expression, with UBAC2 deficiency leading to increased protein levels of IFIT1 and MX1, both encoded by ISGs .

What is the impact of UBAC2 mutations on ER-phagy and disease susceptibility?

Several UBAC2 variants have been identified as somatic mutations associated with inflammatory diseases. Specific mutations (R277C, F279S, G293S) dramatically decrease the interaction between UBAC2 and GABARAP, thus impairing ER-phagy function . In experimental models, these mutations significantly reduce the accumulation of cleaved RFP fragments in the ss-RFP-GFP-KDEL ER-phagy receptor assay, confirming their inhibitory effect on ER-phagy . In mouse models, expression of mutated UBAC2 in dextran sulfate sodium (DSS)-induced colitis results in greater body weight loss compared to wild-type UBAC2 expression, demonstrating increased disease susceptibility . This suggests that functional UBAC2 has a protective role against inflammatory conditions, and mutations that impair this function enhance disease risk.

How does UBAC2 interact with the unfolded protein response (UPR)?

UBAC2 functions as a negative regulator of the unfolded protein response (UPR), a cellular stress response activated by ER stress. UBAC2 knockout increases the protein abundance of ER stress markers upon treatment with ER stress inducers, indicating enhanced UPR activation . The regulatory role of UBAC2 in UPR signaling depends on its function as an ER-phagy receptor, as mutations in the LIR motif that disrupt interaction with GABARAP fail to suppress ER stress markers . Additionally, MARK2-dependent phosphorylation of UBAC2 is essential for its ability to suppress ER stress-induced transcripts, as demonstrated by experiments showing that MARK2 deficiency abrogates UBAC2's suppressive effects on both UPR and inflammatory gene transcription .

What expression systems are optimal for recombinant Macaca fascicularis UBAC2 production?

Based on similar recombinant protein production methods, E. coli represents an effective expression system for producing recombinant Macaca fascicularis UBAC2 . When using prokaryotic expression systems, researchers should consider using N-terminal tags such as 6xHis-SUMO to enhance solubility and facilitate purification . The expression region should focus on the functional domains of interest; for extracellular domain studies, positions 24-297 have been successfully expressed in other recombinant macaque proteins . For researchers requiring post-translational modifications, especially phosphorylation events critical to UBAC2 function, mammalian expression systems like HEK293 or CHO cells might be more appropriate, despite not being explicitly mentioned in the provided sources.

What purification strategies yield high-purity recombinant UBAC2?

For His-tagged recombinant UBAC2, immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins provides effective initial purification. This should be followed by size exclusion chromatography to remove aggregates and achieve higher purity. The target purity standard should be greater than 90% as determined by SDS-PAGE analysis . For SUMO-tagged constructs, additional purification using SUMO protease cleavage followed by reverse IMAC can remove the tag and further increase purity. Storage in Tris-based buffer with 50% glycerol is recommended for maintaining protein stability . To avoid protein degradation, aliquots should be prepared and stored at -20°C or -80°C, with lyophilized forms offering extended shelf life (12 months) compared to liquid formulations (6 months) .

How can researchers effectively measure UBAC2-mediated ER-phagy?

The ss-RFP-GFP-KDEL ER-phagy receptor assay represents a robust method for measuring UBAC2-mediated ER-phagy . This fluorescence-based assay utilizes a construct containing signal sequence-directed RFP-GFP fusion protein with a KDEL ER-retention motif. Upon ER-phagy induction, the construct is delivered to lysosomes, where the acidic environment quenches GFP fluorescence while RFP remains stable, resulting in red-only puncta and the accumulation of cleaved RFP fragments detectable by western blotting . Researchers can quantify ER-phagy flux by:

  • Measuring the number of red puncta in fluorescence microscopy

  • Assessing the accumulation of cleaved RFP fragments via immunoblotting

  • Monitoring ER content using ER-specific dyes or markers

For validation, electron microscopy can be employed to visualize ER sequestration into autophagosomes directly. Co-localization studies with UBAC2 and autophagy markers (WIPI2, ATG16L1, LAMP1) provide additional evidence of ER-phagy progression .

What experimental models are suitable for studying UBAC2 function in inflammation?

Several experimental models are effective for studying UBAC2's role in inflammation:

  • Cell culture models: UBAC2 knockout cell lines (generated via CRISPR-Cas9) in relevant cell types such as HeLa, THP-1 (monocytic), and HT-29 (intestinal epithelial) cells allow investigation of UBAC2's cellular functions .

  • Animal models: AAV-delivered shRNA knockdown of UBAC2 in mice, combined with disease models such as DSS-induced colitis, provides an in vivo system to study UBAC2's role in inflammatory conditions .

  • Inflammatory induction methods:

    • ER stress inducers: Thapsigargin (TG) or Tunicamycin (TM) treatment

    • DSS administration for colitis models

    • Cytokine challenge (TNFα, IL-1β)

  • Readout parameters:

    • Inflammatory cytokine production (IL-6, TNFα, IL-1β)

    • ER stress marker expression

    • NF-κB pathway activation (p65 phosphorylation)

    • ISG-encoded protein levels (IFIT1, MX1)

    • Clinical parameters in animal models (weight loss, colon length)

What techniques can assess UBAC2 phosphorylation status and dimerization?

To analyze UBAC2 phosphorylation and dimerization, researchers can employ the following techniques:

  • Phosphorylation analysis:

    • Phospho-specific antibodies against UBAC2 pS223

    • Phos-tag SDS-PAGE for mobility shift detection of phosphorylated species

    • Mass spectrometry to identify phosphorylation sites

    • In vitro kinase assays with recombinant MARK2 and UBAC2

  • Dimerization assessment:

    • Non-reducing SDS-PAGE to preserve disulfide-mediated interactions

    • Chemical crosslinking followed by SDS-PAGE

    • Förster resonance energy transfer (FRET) using fluorescently tagged UBAC2 variants

    • Size exclusion chromatography to separate monomeric and dimeric forms

  • Interaction studies:

    • Co-immunoprecipitation to assess UBAC2-GABARAP interaction strength

    • Pull-down assays with recombinant proteins

    • Bioluminescence resonance energy transfer (BRET) for live-cell interaction monitoring

    • Proximity ligation assays to visualize protein-protein interactions in situ

How can UBAC2 research inform therapeutic approaches for inflammatory diseases?

Research on UBAC2 provides several avenues for developing therapeutic approaches for inflammatory diseases:

  • UBAC2 stabilization strategies: Since UBAC2 functions as a negative regulator of inflammatory responses, approaches that enhance UBAC2 stability or prevent its degradation could offer therapeutic benefits. The proteasome inhibitor PS-341 has been shown to alleviate chronic low-grade inflammation by inhibiting protein degradation .

  • MARK2 activation: Given that MARK2-mediated phosphorylation of UBAC2 enhances its ER-phagy function, compounds that promote MARK2 activity could potentially boost UBAC2's anti-inflammatory effects.

  • ER-phagy modulation: Targeting the ER-phagy pathway more broadly represents another therapeutic approach. Since UBAC2 suppresses inflammatory responses through ER-phagy, compounds that promote this process could help manage inflammatory conditions.

  • Personalized medicine applications: Genetic screening for UBAC2 variants (R277C, F279S, G293S) could identify individuals at higher risk for inflammatory diseases, allowing for personalized preventive approaches .

What are the key considerations for studying UBAC2 in non-human primate models?

When studying UBAC2 in Macaca fascicularis and other non-human primate models, researchers should consider:

  • Species-specific differences: While UBAC2 is highly conserved, subtle differences between human and macaque versions may affect protein function, interactions, or regulatory mechanisms.

  • Ethical considerations: Non-human primate research requires stringent ethical oversight. Researchers should implement the 3Rs principle (Replacement, Reduction, Refinement) and obtain proper institutional approvals.

  • Model relevance: For translational research, researchers should verify that macaque UBAC2 functions similarly to human UBAC2 in the context under study. This includes confirming conservation of key domains (LIR motif), phosphorylation sites, and interaction partners.

  • Reagent availability: Species-specific antibodies, genetic tools, and other reagents may be limited for Macaca fascicularis compared to human or mouse models. Researchers may need to develop or validate custom reagents.

  • Genetic manipulation approaches: CRISPR-Cas9 or RNAi approaches may require optimization for macaque cells, with consideration of delivery methods and off-target effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.