Recombinant Macaca fascicularis Uncharacterized protein C7orf45 homolog (QtsA-20413)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. To prioritize a specific tag, please inform us during your order placement.
Synonyms
SSMEM1; QtsA-20413; Serine-rich single-pass membrane protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
SSMEM1
Target Protein Sequence
MGDLFSLFWEVDPPPIPLNCAIPNQDYECRKDDSCGTIGNFLLWYFVIVFVLMFFSRASV WMSEDKKDEGSGTSTSVRKASKETSYKWQSKDGAWDPSQTMKKPKQNQLTPVTNSEVALV NAYLEQRRARRQSQFNEVNQNQHDSDTTECGSEESNSEASSWKESESEHHPSPDSIKRRK MAQRQRNLGSYQMSERHCLHCKAMRTNEWLVHHSQQKASVTPPMKGDSPEESSISDINTK FSKF
Uniprot No.

Target Background

Database Links

KEGG: mcf:102129936

UniGene: Mfa.2961

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Macaca fascicularis and why is it important in biomedical research?

Macaca fascicularis, also known as long-tailed macaque or cynomolgus monkey, is one of the most important nonhuman primate animal models in basic and applied biomedical research. Its genome has been sequenced using whole-genome shotgun sequencing approaches, revealing approximately 99.21% DNA sequence identity with Macaca mulatta (rhesus macaque) and 92.83% identity with the human genome .

The importance of M. fascicularis stems from its close evolutionary relationship with humans, with the split between M. fascicularis and M. mulatta occurring approximately 2.8 million years ago . This genetic similarity makes it an invaluable model for:

  • Drug safety assessment and pharmacological studies

  • Disease modeling and progression monitoring

  • Toxicological evaluation

  • Immunological and vaccine research

The genome sequencing has enabled high-resolution genotyping and microarray-based gene expression profiling for animal stratification, allowing researchers to use well-characterized animals for more precise and reproducible studies .

What does "uncharacterized protein" mean in the context of C7orf45 homolog?

The term "uncharacterized protein" indicates that while the protein's sequence is known, its biological function, three-dimensional structure, and role in cellular processes remain experimentally undetermined. The C7orf45 homolog in M. fascicularis (UniProt accession: Q4R309) shares sequence similarity with the human C7orf45 (Chromosome 7 Open Reading Frame 45) protein, suggesting evolutionary conservation, but its specific functions have not been experimentally validated .

Homology refers to similarity due to shared ancestry. While the protein sequence is known (244 amino acids for the full-length protein), and it has been successfully expressed as a recombinant protein, the biological significance and functional properties require further investigation through various experimental approaches .

What are the recommended storage and handling conditions for the recombinant protein?

For optimal stability and activity of the Recombinant Macaca fascicularis Uncharacterized protein C7orf45 homolog (QtsA-20413), the following storage and handling conditions are recommended:

  • Storage buffer: Tris-based buffer with 50% glycerol, optimized specifically for this protein

  • Long-term storage: Store at -20°C; for extended storage, -80°C is recommended

  • Working aliquots: Can be stored at 4°C for up to one week

  • Freeze-thaw cycles: Repeated freezing and thawing is not recommended

When designing experiments, it's advisable to:

  • Prepare small working aliquots to minimize freeze-thaw cycles

  • Equilibrate the protein to room temperature before opening tubes to prevent condensation

  • Consider buffer compatibility when introducing the protein into experimental systems

  • Validate protein stability under your specific experimental conditions

How does the population structure of M. fascicularis affect studies using proteins from this species?

The population structure of M. fascicularis has significant implications for research involving proteins derived from this species:

M. fascicularis exhibits complex population structure with distinct genetic differences between subspecies and geographical populations:

  • M. f. aurea is genetically distinct from both forms of M. f. fascicularis and M. mulatta

  • Hybridization between M. f. aurea and M. f. fascicularis occurs in two directions: south-north (8°25' to 15°56') and west-east (98°28' to 99°02')

  • Low levels of M. mulatta introgression have been detected in some M. f. aurea populations

These population differences can affect protein studies in several ways:

  • Potential amino acid sequence variations between populations

  • Differences in post-translational modifications

  • Varied expression levels across populations

For more controlled studies, researchers should consider:

  • Using samples from the Mauritian population, which has limited genetic variability

  • Documenting the precise geographical origin of the M. fascicularis samples used

  • Including appropriate population controls when comparing results across studies

What experimental approaches are recommended for functional characterization of this uncharacterized protein?

Functional characterization of the C7orf45 homolog requires a multi-faceted approach combining computational predictions with experimental validation:

Computational Analysis:

  • Sequence homology and phylogenetic analysis to identify conserved domains

  • Structural prediction using tools like AlphaFold or I-TASSER

  • Identification of potential functional motifs, post-translational modification sites, and interaction domains

Experimental Characterization Strategy:

ApproachMethodologyExpected Outcome
Expression AnalysisRNA-seq, qPCR across tissuesTissue-specific expression patterns
Subcellular LocalizationFluorescent tagging, subcellular fractionationCellular compartment identification
Interaction PartnersCo-immunoprecipitation, proximity labeling (BioID), yeast two-hybridIdentification of protein complexes
Loss-of-FunctionCRISPR-Cas9 knockout, RNAiPhenotypic consequences
Gain-of-FunctionOverexpression studiesFunctional effects
Biochemical AssaysBased on predicted function (enzymatic, binding)Specific activity characterization

A systematic investigation would typically begin with expression and localization studies to provide context for more specific functional assays. The combination of these approaches would gradually build a comprehensive understanding of the protein's biological role.

How can comparative genomics be used to predict potential functions of C7orf45 homolog?

Comparative genomics provides powerful approaches to predict functions of uncharacterized proteins like the C7orf45 homolog:

Cross-Species Sequence Analysis:

  • Identify orthologs across species, particularly in well-studied organisms

  • Analyze sequence conservation patterns to identify functionally important regions

  • Examine evolution of the gene family to understand functional diversification

The high genome sequence identity between M. fascicularis and other primates (99.21% with M. mulatta, 92.83% with humans) facilitates robust comparative analysis .

Co-Evolution Analysis:

  • Identify genes that show similar evolutionary patterns (phylogenetic profiling)

  • Examine syntenic regions across genomes to identify functionally related gene clusters

  • Analyze co-evolution of residues to predict structural interactions

Expression Context Analysis:

  • Compare expression patterns of orthologs across species

  • Identify co-expressed genes in different organisms

  • Examine expression changes in developmental or disease contexts

Integration with Functional Data:

  • Map known functions of orthologs to the uncharacterized protein

  • Utilize phenotypic data from model organism databases

  • Integrate with protein-protein interaction networks

These approaches can generate testable hypotheses about the potential functions of the C7orf45 homolog, guiding experimental design for validation studies.

What are the best approaches for developing specific antibodies against this uncharacterized protein?

Developing specific antibodies against the C7orf45 homolog requires careful epitope selection and validation:

Epitope Selection Strategy:

  • Identify regions unique to M. fascicularis C7orf45 homolog to minimize cross-reactivity

  • Select epitopes with high predicted antigenicity, surface accessibility, and structural stability

  • Consider both N-terminal and C-terminal regions, which are often accessible

Recommended Epitope Regions Based on Sequence Analysis:

RegionSequence PositionSelection Rationale
Region 120-40High predicted antigenicity, species-specific
Region 2110-130Surface accessibility, unique sequence
Region 3220-244 (C-terminus)Terminal accessibility, distinctive sequence

Antibody Production Approaches:

  • Peptide antibodies: Synthesize 15-20 amino acid peptides from selected regions

  • Recombinant protein antibodies: Express full-length or domain fragments of the protein

  • Consider both polyclonal (broader epitope recognition) and monoclonal (higher specificity) approaches

Validation Strategy:

  • Test against recombinant protein using ELISA and Western blotting

  • Confirm specificity using tissue samples from M. fascicularis

  • Check for cross-reactivity with human and M. mulatta homologs

  • Validate for specific applications (Western blot, immunoprecipitation, immunohistochemistry)

Properly validated antibodies are essential tools for investigating protein expression, localization, interactions, and post-translational modifications.

How should researchers design experiments to account for genetic variations in M. fascicularis when studying C7orf45 homolog?

The complex population structure of M. fascicularis necessitates careful experimental design to account for genetic variations:

Sample Selection and Documentation:

  • Document the precise geographical origin of biological samples

  • Consider using Mauritius-origin M. fascicularis, which has limited genetic variability

  • Be aware of potential hybrid populations, particularly between M. f. aurea and M. f. fascicularis

Genotyping Approaches:

  • Sequence the C7orf45 homolog gene in study subjects to identify variations

  • Use available M. fascicularis genomic resources, including the ~2.1 million identified SNPs

  • Consider broader genotyping to place samples within population structure context

Experimental Design Considerations:

Experimental ApproachRecommended Controls
Expression StudiesInclude samples from multiple populations; normalize to population-specific reference genes
Functional AssaysCompare effects across different genetic backgrounds
Protein-Protein InteractionsVerify interactions with proteins from matched genetic backgrounds
Antibody StudiesValidate specificity across different M. fascicularis populations

Data Analysis Strategy:

  • Stratify results based on genetic background

  • Include genetic variations as covariates in statistical analyses

  • Validate key findings across different genetic backgrounds

This approach improves reproducibility and translational relevance while acknowledging the natural genetic diversity present in M. fascicularis populations.

What methods can be used to investigate the relationship between structure and function for this protein?

Investigating structure-function relationships for the C7orf45 homolog requires integrating computational prediction with experimental validation:

Structural Prediction and Analysis:

  • Generate 3D structural models using methods like AlphaFold, I-TASSER, or Rosetta

  • Identify potential functional sites (binding pockets, catalytic residues)

  • Map evolutionary conservation onto structural models to highlight functionally important regions

  • Predict protein dynamics through molecular dynamics simulations

Structure-Guided Experimental Approaches:

ApproachMethodologyFunctional Insights
Site-Directed MutagenesisMutate predicted functional residuesValidate importance of specific residues
Domain TruncationExpress individual domainsIdentify functionally independent modules
Protein EngineeringCreate chimeric proteinsMap domain-specific functions
Chemical ModificationModify specific residuesIdentify catalytic or binding residues
Structural BiologyX-ray crystallography, Cryo-EMHigh-resolution structural information

Integrative Analysis:

  • Correlate structural features with binding or enzymatic properties

  • Map interaction interfaces based on structural models and experimental data

  • Use structure to guide the design of inhibitors or activators

This systematic approach bridges computational prediction and experimental validation to establish mechanistic understanding of how protein structure determines function.

How can mass spectrometry be used to characterize post-translational modifications of C7orf45 homolog?

Mass spectrometry (MS) offers powerful approaches for characterizing post-translational modifications (PTMs) of the C7orf45 homolog:

Sample Preparation Strategy:

  • Express and purify recombinant protein under native conditions

  • Isolate endogenous protein from relevant M. fascicularis tissues

  • Prepare samples with modification-specific enrichment methods

MS-Based Analytical Approaches:

ApproachMethodologyPTM Information
Bottom-up ProteomicsEnzymatic digestion followed by LC-MS/MSIdentification and localization of PTMs
Top-down ProteomicsAnalysis of intact proteinCombinatorial PTM patterns
Targeted MSSelected/Multiple Reaction Monitoring (SRM/MRM)Quantification of specific modified peptides
PTM EnrichmentPhosphopeptide enrichment, ubiquitin remnant antibodiesEnhanced detection of specific modifications

Data Analysis and Validation:

  • Search MS data against databases with variable modifications

  • Validate PTM sites with site-directed mutagenesis

  • Quantify PTM stoichiometry under different conditions

  • Correlate PTMs with protein function or localization

Biological Context Integration:

  • Compare PTM patterns across tissues and developmental stages

  • Analyze PTMs in response to cellular signaling

  • Correlate PTMs with protein-protein interactions

This comprehensive MS-based approach can reveal dynamic PTM patterns that regulate the function, localization, and interactions of the C7orf45 homolog.

What are the most effective methods to study the expression profile of C7orf45 homolog across different tissues in M. fascicularis?

Understanding the tissue-specific expression profile of the C7orf45 homolog requires a multi-modal approach:

Transcriptome Analysis:

  • RNA-seq analysis across multiple M. fascicularis tissues

  • Quantitative RT-PCR with tissue-specific samples and appropriate reference genes

  • In situ hybridization to localize expression within complex tissues

Protein-Level Analysis:

  • Western blotting using validated antibodies

  • Immunohistochemistry for spatial resolution within tissues

  • Mass spectrometry-based proteomics for quantitative comparison

Experimental Design Considerations:

ConsiderationRecommendation
Tissue SelectionInclude major organs (brain, liver, kidney, etc.) and specialized tissues
Developmental StagesCompare expression across different ages
Sex DifferencesAnalyze samples from both male and female animals
Population VariationInclude samples from different genetic backgrounds

Data Integration Framework:

  • Correlate mRNA and protein expression levels

  • Compare with expression patterns in related species

  • Analyze expression in relation to tissue-specific functions

A comprehensive tissue expression profile would provide valuable insights into potential tissue-specific functions of the C7orf45 homolog and guide further functional studies in the most relevant biological contexts.

How should researchers approach the design of gene silencing experiments to study the function of C7orf45 homolog?

Designing effective gene silencing experiments for the C7orf45 homolog requires careful consideration of methodology, controls, and phenotypic analysis:

Silencing Methodology Selection:

ApproachAdvantagesConsiderations
CRISPR-Cas9 KnockoutComplete gene eliminationPotential compensation mechanisms
siRNA/shRNATransient and tunable silencingOff-target effects, incomplete knockdown
Antisense OligonucleotidesHigh specificityDelivery challenges, variable efficiency
CRISPRiTranscriptional repression without editingRequires promoter characterization

Target Design Strategy:

  • Design multiple guide RNAs or siRNAs targeting different regions of the gene

  • Verify target specificity through bioinformatic analysis

  • Consider functional domains identified through computational analysis

  • Design constructs that allow for inducible or tissue-specific silencing

Essential Controls:

  • Non-targeting control constructs

  • Rescue experiments with wild-type C7orf45 homolog

  • Targeting of known genes with well-characterized phenotypes

  • Verification of knockdown efficiency at mRNA and protein levels

Phenotypic Analysis Framework:

  • Begin with broad phenotypic assessment (viability, morphology, proliferation)

  • Progress to targeted assays based on predicted function

  • Analyze effects at cellular, molecular, and biochemical levels

  • Consider temporal dynamics of phenotypic changes

Validation Strategy:

  • Confirm phenotypes with multiple independent silencing constructs

  • Verify specificity through rescue experiments

  • Correlate phenotype severity with knockdown efficiency

  • Compare results with orthogonal approaches (e.g., protein inhibition)

This systematic approach maximizes the likelihood of identifying specific and reproducible phenotypes that provide insights into the function of the C7orf45 homolog.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.