Recombinant Macaca fascicularis Voltage-dependent calcium channel gamma-3 subunit (CACNG3)

Shipped with Ice Packs
In Stock

Description

Research Applications

Recombinant Macaca fascicularis CACNG3 is primarily utilized in preclinical research, particularly for:

ApplicationDetails
ELISA DevelopmentUsed as a standard in sandwich ELISA assays to quantify CACNG3 levels in biological samples .
Structural StudiesRecombinant protein facilitates antibody production and epitope mapping .
Cross-Species Comparative StudiesEnables functional analysis of calcium channel subunit evolution and conservation .

Comparative Analysis

The Macaca fascicularis CACNG3 shares high sequence identity with primate and rodent orthologs, as shown below:

SpeciesUniprot IDSequence Identity to HumanKey Functional Features
Macaca fascicularisQ4R589~97% (estimated)TARP activity, calcium channel stabilization
Homo sapiensO60359N/ALinked to epilepsy and glioma prognosis
Mus musculusQ8BZ37~97% (human fragment)Stargazin homolog; absence seizure association

Research Gaps and Future Directions

While recombinant Macaca fascicularis CACNG3 is a valuable tool for primate-specific studies, critical gaps remain:

  • Functional Studies: No direct evidence of its role in macaque neurophysiology or disease models.

  • Disease Relevance: Potential links to neurological disorders (e.g., epilepsy, glioma) require validation.

  • Therapeutic Targets: Unexplored utility in developing calcium channel modulators for neurodegenerative conditions.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your application.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CACNG3; QccE-13852; Voltage-dependent calcium channel gamma-3 subunit; Neuronal voltage-gated calcium channel gamma-3 subunit; Transmembrane AMPAR regulatory protein gamma-3; TARP gamma-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-315
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
Target Protein Sequence
MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTH SGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGL CVAASEFHRSRHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFY FGAFSFIIAEIVGVVAVHIYIEKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRST EPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPKEFK ESLHNNPANRRTTPV
Uniprot No.

Target Background

Function
This protein regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs) within the somatodendritic compartment. It facilitates AMPAR targeting to the cell membrane and synapses, modulating their gating kinetics by slowing activation, deactivation, and desensitization rates. Its regulation of AMPAR subunits is not subunit-specific, affecting all subunits. It is also believed to stabilize calcium channels in an inactivated (closed) state.
Database Links

KEGG: mcf:101926678

UniGene: Mfa.8567

Protein Families
PMP-22/EMP/MP20 family, CACNG subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the Voltage-dependent calcium channel gamma-3 subunit (CACNG3) and what are its primary functions?

The Voltage-dependent calcium channel gamma-3 subunit (CACNG3) serves dual roles in neuronal function. It primarily regulates the trafficking of AMPA-selective glutamate receptors (AMPARs) to the somatodendritic compartment and modulates their gating properties. CACNG3 promotes AMPAR targeting to cell membranes and synapses while influencing their functional characteristics by slowing rates of activation, deactivation, and desensitization . This protein does not show subunit-specific AMPA receptor regulation but rather affects all AMPAR subunits universally .

Additionally, CACNG3 is thought to stabilize voltage-dependent calcium channels in an inactivated (closed) state, thereby regulating calcium influx into neurons . The protein contains four transmembrane domains with both N and C termini located intracellularly, allowing it to interact with both membrane components and cytoplasmic signaling molecules. This structural arrangement enables CACNG3 to function as a critical regulatory component in neuronal signaling pathways dependent on both calcium channels and glutamate receptors.

How similar are Macaca fascicularis and human CACNG3 proteins, and what implications does this have for translational research?

While the search results don't provide specific sequence comparison data between Macaca fascicularis and human CACNG3, we can draw insights from the phylogenetic relationship between these species. Macaques are much closer phylogenetically to humans than rodents, making them valuable translational models . This close evolutionary relationship typically results in high protein homology, with many macaque proteins sharing 90-95% sequence identity with their human counterparts.

What experimental systems are best suited for studying recombinant Macaca fascicularis CACNG3?

For recombinant expression of Macaca fascicularis CACNG3, E. coli expression systems have been successfully employed for human CACNG3 and would likely be suitable for the macaque ortholog as well. E. coli systems provide high yield and cost-effectiveness for producing the full-length protein (315 amino acids for human CACNG3) . This approach is particularly valuable for structural studies, antibody production, and protein-protein interaction assays.

For functional studies investigating CACNG3's role in ion channel regulation, mammalian expression systems (such as HEK293 or CHO cells) provide a more native-like environment with appropriate post-translational modifications and membrane trafficking machinery. These systems enable co-expression with AMPA receptors or calcium channels to study functional interactions. Primary neuronal cultures from Macaca fascicularis, while technically challenging, offer the most physiologically relevant context for investigating CACNG3 function in its native cellular environment, particularly for electrophysiological measurements of channel properties.

What purification strategies yield optimal results for recombinant Macaca fascicularis CACNG3?

Purification of recombinant Macaca fascicularis CACNG3 typically employs affinity chromatography approaches, similar to those used for human CACNG3. For His-tagged constructs (such as the N-terminal 10xHis-tag used in commercial human CACNG3) , nickel or cobalt affinity chromatography provides excellent initial purification. This should be followed by size exclusion chromatography to remove aggregates and ensure monodispersity.

The hydrophobic nature of CACNG3, which contains multiple transmembrane domains , presents significant purification challenges. Researchers should incorporate mild detergents (such as n-dodecyl-β-D-maltoside or CHAPS) throughout purification to maintain protein solubility and native conformation. For highest purity (>95%), ion exchange chromatography may be employed as a polishing step after affinity purification. Protein quality should be assessed via SDS-PAGE, with expected purity of at least 85% , and Western blotting with CACNG3-specific antibodies to confirm identity. For functional studies, researchers should verify that the purification process preserves the protein's ability to interact with target molecules through binding assays or surface plasmon resonance.

How should recombinant Macaca fascicularis CACNG3 be stored to maintain optimal activity?

Proper storage of recombinant Macaca fascicularis CACNG3 is critical for maintaining its structural integrity and functional activity. Based on protocols for human CACNG3, the protein should be stored in either liquid form in Tris/PBS-based buffer with 5-50% glycerol, or as a lyophilized powder . For liquid formulations, storage at -20°C/-80°C provides a shelf life of approximately 6 months .

If provided as lyophilized powder, reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL, followed by addition of glycerol to a final concentration of 5-50% before aliquoting for long-term storage at -20°C/-80°C . The addition of reducing agents such as DTT (1-5 mM) may help prevent disulfide bond formation and maintain protein stability. Researchers should avoid repeated freeze-thaw cycles, which can significantly diminish protein activity, by storing the protein in small single-use aliquots. For projects requiring extended storage periods, lyophilized preparations are generally preferable, with reconstitution performed immediately prior to experimental use.

What functional assays can validate the activity of recombinant Macaca fascicularis CACNG3?

Validating the functional activity of recombinant Macaca fascicularis CACNG3 requires assays that assess its dual roles in AMPAR regulation and calcium channel modulation. For AMPAR trafficking function, researchers should employ co-immunoprecipitation assays to verify CACNG3 interaction with AMPAR subunits, followed by surface biotinylation assays in heterologous expression systems to quantify CACNG3-dependent changes in receptor surface expression.

Electrophysiological patch-clamp recordings provide the gold standard for assessing CACNG3's effects on AMPAR gating kinetics, specifically measuring changes in activation, deactivation, and desensitization rates when co-expressed with AMPAR subunits. Similarly, whole-cell patch-clamp recordings of voltage-dependent calcium currents can demonstrate CACNG3's ability to stabilize calcium channels in their inactivated state .

Fluorescence-based calcium imaging using calcium-sensitive dyes represents another approach for assessing CACNG3's impact on calcium channel function in cellular contexts. For high-throughput screening applications, researchers can develop cell-based reporter assays where CACNG3-dependent changes in AMPAR or calcium channel function are coupled to easily measurable outputs such as fluorescence or luminescence.

How does CACNG3 function differ across brain regions in Macaca fascicularis, and what experimental approaches best capture this diversity?

The functional diversity of CACNG3 across Macaca fascicularis brain regions likely reflects its differential expression patterns and interaction with region-specific protein partners. While the search results don't provide specific data on regional differences, researchers can employ several approaches to investigate this diversity. RNA-seq and quantitative proteomics of discrete brain regions can establish expression profiles, while immunohistochemistry using anti-CACNG3 antibodies enables visualization of protein distribution across neuroanatomical structures.

For functional characterization, acute brain slice preparations from different regions allow electrophysiological assessment of native CACNG3 activity in preserved neural circuits. Researchers can apply AMPAR-selective agonists and measure region-specific differences in receptor kinetics that may reflect varied CACNG3 influence. Viral-mediated expression of tagged CACNG3 variants in specific brain regions, followed by immunoprecipitation and mass spectrometry, can identify region-specific protein interaction networks.

Calcium imaging in brain slice preparations from different regions further enables assessment of CACNG3's impact on calcium dynamics in native neural circuits. These complementary approaches can create a comprehensive map of CACNG3 functional diversity across the Macaca fascicularis brain, providing valuable insights into its role in region-specific information processing.

What are the challenges in developing CACNG3 knockout or knockdown models in Macaca fascicularis, and how might these be overcome?

Developing CACNG3 knockout or knockdown models in Macaca fascicularis presents significant technical, ethical, and resource challenges compared to rodent models. The extended breeding cycle and limited number of offspring make traditional breeding-based knockout strategies impractical. Additionally, the higher ethical standards and regulatory requirements for non-human primate research necessitate careful justification and refinement of approaches.

CRISPR/Cas9 technology offers the most promising approach for generating CACNG3 knockout macaques, though efficiency remains lower than in rodents. For regional or temporally controlled CACNG3 manipulation, viral vector-mediated delivery of shRNA (for knockdown) or Cas9/gRNA (for knockout) provides greater experimental flexibility. AAV vectors with neuron-specific promoters can achieve targeted CACNG3 manipulation in discrete brain regions without requiring germline modification.

For functional studies where complete knockout is unnecessary, antisense oligonucleotides delivered via intrathecal injection can achieve transient CACNG3 knockdown. Alternatively, dominant-negative CACNG3 mutants overexpressed in specific brain regions can disrupt endogenous CACNG3 function without requiring gene editing. Each approach has distinct advantages regarding specificity, temporal control, and technical feasibility, and researchers must carefully consider which best addresses their specific experimental questions while minimizing ethical concerns.

How can researchers address species differences when extrapolating CACNG3 findings from Macaca fascicularis to human applications?

While Macaca fascicularis provides a valuable model for human neurophysiology due to phylogenetic proximity , researchers must systematically address species differences when translating CACNG3 findings. Comparative sequence analysis using bioinformatics tools should identify divergent regions between macaque and human CACNG3 that might affect function or protein interactions. These analyses should extend beyond the coding sequence to include promoter regions and splice variants that might alter expression patterns.

Functional assays that directly compare human and macaque CACNG3 in identical experimental systems (e.g., heterologous expression in HEK293 cells) can quantify differences in channel modulation, protein interaction, or cellular localization. Using humanized systems—such as human induced pluripotent stem cell (iPSC)-derived neurons expressing macaque CACNG3—enables assessment of species-specific functional differences in a human cellular background.

For translational studies targeting CACNG3 therapeutically, species differences in pharmacology must be addressed using comparative binding and functional assays with potential drug candidates. Despite the general similarities between macaque and human neurophysiology, researchers should acknowledge that historical examples like the CD28 superagonist monoclonal antibody (TGN1412) demonstrate that critical differences can exist in immune and other physiological systems between macaques and humans . This underscores the importance of additional validation steps when translating findings across species.

How does CACNG3 interact with the Major Histocompatibility Complex (MHC) in Macaca fascicularis experimental models?

While direct interactions between CACNG3 and MHC proteins are not documented in the search results, the MHC polymorphism in Macaca fascicularis significantly impacts immune responses and experimental outcomes in many research areas . CACNG3 studies must account for this variation, particularly when experimental readouts involve inflammatory or immune responses. For example, neuroinflammatory processes that might affect calcium channel function could be influenced by the MHC genotype of experimental animals.

For studies involving multiple animals, researchers should consider MHC genotyping and matching across experimental groups to minimize variability stemming from genetic differences . This is especially important in studies evaluating cell-based therapies or gene transfer approaches targeting CACNG3, where immune recognition of foreign proteins may be influenced by MHC-dependent antigen presentation.

The search results indicate that "in most therapeutic trials, it is crucial that animals in the treated and control groups are matched as closely as possible for their MHC type" . This principle applies to CACNG3 research involving therapeutic interventions or when comparing results across different experimental cohorts. Researchers should report MHC genotypes of experimental animals in publications to facilitate interpretation and reproducibility of findings related to CACNG3 function in Macaca fascicularis models.

What methodological approaches best characterize the interactions between CACNG3 and AMPA receptors in Macaca fascicularis neurons?

Characterizing CACNG3-AMPAR interactions in Macaca fascicularis neurons requires complementary molecular, biochemical, and electrophysiological approaches. Co-immunoprecipitation from macaque brain tissue followed by mass spectrometry can identify the stoichiometry and composition of native CACNG3-AMPAR complexes. Proximity ligation assays in fixed brain tissue provide spatial information about these interactions across different subcellular compartments and brain regions.

For dynamic interaction studies, live-cell imaging of fluorescently tagged CACNG3 and AMPAR subunits in macaque primary neuronal cultures can visualize trafficking and co-localization. FRET or BRET approaches offer quantitative measurements of protein proximity in living neurons. Electrophysiological recordings remain essential for functional characterization, with specific protocols designed to isolate CACNG3's effects on AMPAR gating properties.

Molecular manipulation through viral-mediated expression of CACNG3 mutants can identify critical interaction domains affecting AMPAR function. Single-particle tracking of quantum dot-labeled AMPARs in the presence and absence of CACNG3 provides insights into how this auxiliary subunit affects receptor mobility and synaptic stabilization. Combined patch-clamp recording and calcium imaging enables simultaneous assessment of AMPAR function and downstream calcium signaling events modulated by CACNG3. These approaches collectively provide a comprehensive picture of CACNG3-AMPAR interactions in a physiologically relevant primate neuronal context.

What statistical approaches are recommended when designing experiments using recombinant Macaca fascicularis CACNG3 in non-human primate models?

Statistical design for experiments involving recombinant Macaca fascicularis CACNG3 in non-human primate models must account for several factors specific to primate research. Due to ethical and practical constraints limiting sample sizes, power analyses should be conducted during experimental planning to determine the minimal number of animals needed to detect meaningful effects. When possible, within-subject designs should be employed to reduce variability and animal numbers.

The search results emphasize that "in order to improve the power of animal experiments while keeping the number of individuals used as low as possible, it is necessary to select animals sharing a common geographical origin and to systematically select animals with the experimentally appropriate polymorphic alleles" . This principle applies directly to CACNG3 research, where genetic background may influence experimental outcomes.

Mixed-effects models are particularly suitable for analyzing longitudinal data from CACNG3 studies, as they can account for both fixed effects (experimental conditions) and random effects (individual differences between animals). Non-parametric statistical methods may be necessary when normality assumptions cannot be met due to small sample sizes. Researchers should consider implementing Bayesian statistical approaches, which can be more robust with small sample sizes and allow incorporation of prior knowledge from related studies. For all analyses, effect sizes should be reported alongside p-values to provide a more complete picture of CACNG3's biological significance.

How can recombinant Macaca fascicularis CACNG3 be used in drug discovery for neurological disorders?

Recombinant Macaca fascicularis CACNG3 provides a valuable tool for drug discovery targeting neurological disorders, particularly those involving glutamatergic signaling or calcium homeostasis dysregulation. High-throughput screening assays can be developed using recombinant CACNG3 to identify compounds that modulate its interactions with AMPA receptors or calcium channels. These might include fluorescence-based binding assays or FRET-based interaction assays suitable for large compound libraries.

The human CACNG3 protein has documented interactions with several approved and experimental drugs, including Butamben (inhibitor), Bioallethrin (agonist), and various calcium channel modulators like Verapamil and Nicardipine (inhibitors) . These established pharmacological interactions provide starting points for developing Macaca fascicularis CACNG3-specific modulators.

Structure-activity relationship studies comparing drug binding to human and macaque CACNG3 can identify species-conserved binding pockets for therapeutic targeting. For validation of promising compounds, electrophysiological assays in macaque brain slice preparations offer a physiologically relevant system to assess drug effects on CACNG3-modulated synaptic transmission. The translational value of these approaches is enhanced by the phylogenetic proximity between macaques and humans , increasing the likelihood that drug effects observed in macaque models will translate to human patients. As the search results note, "the use of a nonhuman primate model is justified by the absence of alternative animal models such as mouse or rat" for many neurological conditions, making CACNG3 studies in macaques particularly valuable for therapeutic development.

What ethical considerations should guide research using recombinant Macaca fascicularis CACNG3 in neuroscience studies?

Research utilizing recombinant Macaca fascicularis CACNG3 must adhere to rigorous ethical standards specific to non-human primate studies. The 3Rs principle (Replacement, Reduction, Refinement) should guide experimental design: researchers must justify why alternatives (such as rodent models or in vitro systems) cannot address their research questions, minimize animal numbers through careful statistical planning, and refine protocols to minimize potential suffering.

The search results emphasize that genetic considerations, including MHC typing, can "improve the power of animal experiments while keeping the number of individuals used as low as possible" . This directly applies to CACNG3 research, where appropriate genetic characterization and animal selection can reduce required sample sizes. Researchers should employ ex vivo approaches where possible, such as using brain tissue from animals euthanized for other approved studies to prepare recombinant proteins or conduct slice electrophysiology.

For studies requiring in vivo CACNG3 manipulation, minimally invasive approaches (such as viral vector delivery rather than surgical implantation) should be prioritized. Comprehensive post-experimental animal care protocols must be established, with clear humane endpoints defined before study initiation. All research must receive approval from institutional animal care and use committees with specific expertise in non-human primate research, and should comply with national and international guidelines such as those from the National Research Council's Guide for the Care and Use of Laboratory Animals. Publication of results should include detailed methodological reporting to prevent unnecessary replication of experiments involving non-human primates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.