Recombinant Macaca fascicularis Zinc transporter 1 (SLC30A1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
SLC30A1; ZNT1; QtsA-11880; QtsA-17815; Zinc transporter 1; ZnT-1; Solute carrier family 30 member 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-505
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
Target Protein Sequence
MGCWGRNRGRLLCMLALTFMFMVLEVVVSRVTSSLAMLSDSFHMLSDVLALVVALVAERF ARRTHATQKNTFGWIRAEVMGALVNAIFLTGLCFAILLEAIERFVEPHEMQQPLVVLGVG VAGLLVNVLGLCLFHHHSGFSQDSGHSHSHGSHGHGLPKGPRVKSSRPGSNDINVAPGEQ GPDQEETNTLVANTSNSNGLKLDPADPEKPRSGDTVEVQVNGNLIREPDHVELEEDRAGQ LNMRGVFLHVLGDALGSVIVVVNALVFYFSWKGCSEGDFCVNPCFPDPCKAFVEIINSTH ASVYEAGPCWVLYLDPTLCVVMVCILLYTTYPLLKESALILLQTVPKQIDIRNLIKELRN VEGVEEVHELHVWQLAGSRIIATAHIKCEDPTSYMEVAKTIKDVFHNHGIHATTIQPEFA SVGSKSSVVPCELACRTQCALKQCCGTLPQAHSGKDAEKTPTVSISCLELSNNLEKKPRR TKAENIPAVVIEIKNMPNKQPESSL
Uniprot No.

Target Background

Function
May be involved in cellular zinc efflux.
Database Links

KEGG: mcf:101926515

UniGene: Mfa.6805

Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Macaca fascicularis SLC30A1 and how does it compare to its human ortholog?

Macaca fascicularis SLC30A1 is a member of the cation diffusion facilitator (CDF) family responsible for zinc efflux from the cytoplasm to the extracellular space. Similar to zinc transporters in other organisms, it plays a crucial role in protecting cells from zinc toxicity by reducing cytosolic zinc levels. The protein contains six transmembrane domains with histidine-rich regions that are critical for zinc binding and transport, comparable to the structure observed in fungal zinc transporters like Zrc1 .

The Macaca fascicularis SLC30A1 shares approximately 97% amino acid identity with human SLC30A1, with the highest conservation in the transmembrane domains and metal-binding regions. Key differences are primarily found in the N-terminal cytoplasmic domain, which may affect regulatory interactions with other proteins. Unlike fungal zinc transporters that primarily sequester zinc in vacuoles, mammalian SLC30A1 predominantly functions at the plasma membrane to export excess zinc from the cell.

Table 1: Comparison between Human and Macaca fascicularis SLC30A1

FeatureHuman SLC30A1M. fascicularis SLC30A1
Amino acid length507 aa507 aa
Molecular weight~55 kDa~55 kDa
Transmembrane domains66
Primary localizationPlasma membranePlasma membrane
Post-translational modificationsN-glycosylation, phosphorylationN-glycosylation, phosphorylation
Conserved histidine-rich regionPresent between TM IV and VPresent between TM IV and V
Zinc binding motifsHXXXD, DXXXHHXXXD, DXXXH

What expression systems are recommended for producing recombinant Macaca fascicularis SLC30A1?

Multiple expression systems have been developed for producing recombinant Macaca fascicularis SLC30A1, each with advantages for different research applications. When selecting an expression system, researchers should consider whether native post-translational modifications and protein folding are critical for their studies.

For structural studies requiring larger protein yields, insect cell expression systems (Sf9, High Five) have demonstrated success in producing functional protein with proper folding. For functional assays and localization studies, mammalian expression systems (HEK293, CHO) better preserve native post-translational modifications observed in vivo, similar to how researchers have studied the localization of fungal zinc transporters .

Table 2: Recommended Expression Systems for Recombinant M. fascicularis SLC30A1

Expression SystemAdvantagesDisadvantagesOptimal Applications
E. coli (BL21)High yield, economic, rapid productionLimited post-translational modifications, inclusion body formationTruncated protein domains, antibody production
Insect cells (Sf9)Proper folding of membrane proteins, moderate PTMsModerate yield, higher cost than bacteriaStructural studies, protein-protein interactions
Mammalian cells (HEK293)Native-like PTMs, proper folding and traffickingLower yield, higher cost, longer production timeFunctional studies, localization studies
Yeast (P. pastoris)Higher yields than mammalian, proper foldingDifferent glycosylation patternsLarge-scale protein production, transport assays

How is SLC30A1 expression regulated in Macaca fascicularis cells?

SLC30A1 expression in Macaca fascicularis cells follows a pattern reminiscent of zinc transporters in other organisms, with notable regulatory mechanisms at both transcriptional and post-translational levels. Like fungal zinc transporters, SLC30A1 expression responds to intracellular zinc concentrations, though with important differences in the regulatory direction .

At the transcriptional level, metal-responsive transcription factor-1 (MTF-1) binds to metal response elements (MREs) in the SLC30A1 promoter when zinc levels are elevated, increasing transcription. This contrasts with the pattern observed for fungal Zrc1, which showed increased expression under zinc-limited conditions . Post-transcriptionally, SLC30A1 mRNA stability is regulated by zinc-sensitive RNA-binding proteins.

Post-translationally, SLC30A1 undergoes ubiquitination in response to sustained high zinc levels, leading to protein turnover. Phosphorylation by PKC at conserved serine residues modulates transport activity rather than expression levels. These regulatory mechanisms ensure appropriate zinc efflux capacity based on cellular zinc status.

What methods are effective for detecting recombinant Macaca fascicularis SLC30A1 expression?

Detection of recombinant Macaca fascicularis SLC30A1 requires techniques sensitive to both the protein itself and its functional activity. Western blotting using epitope tags (FLAG, His, GFP) has proven effective for detecting expression levels, similar to techniques used for studying Zrc1 in fungi . When using tag-based detection, researchers should be aware that SLC30A1 often appears at higher molecular weights than predicted due to glycosylation and potential oligomerization, a phenomenon also observed with fungal zinc transporters .

Immunofluorescence microscopy using either tagged constructs or specific antibodies can determine subcellular localization. For functional detection, fluorescent zinc indicators (FluoZin-3, Zinpyr-1) can measure changes in intracellular zinc levels in response to SLC30A1 activity.

Notably, unlike fungal Zrc1 which does not appear to be glycosylated, mammalian SLC30A1 undergoes N-linked glycosylation that can be detected through PNGase F treatment followed by western blotting to observe mobility shifts . This represents an important difference between mammalian and fungal zinc transporters.

What are the optimal conditions for assessing zinc transport activity of recombinant Macaca fascicularis SLC30A1?

Accurate assessment of recombinant Macaca fascicularis SLC30A1 transport activity requires carefully optimized experimental conditions. Researchers should employ complementary approaches including direct zinc measurements and growth-based functional assays.

For cell-based zinc transport assays, expression in zinc-sensitive yeast mutants (such as those lacking endogenous zinc transporters) provides a sensitive system for functional analysis . Growth rescue assays in high-zinc media can confirm SLC30A1 activity, similar to how Zrc1 function was validated in fungal studies . For direct transport measurements, inside-out membrane vesicles prepared from cells expressing recombinant SLC30A1 allow for precise quantification of zinc uptake (representing cellular efflux) using either radioisotopes (⁶⁵Zn) or fluorescent indicators.

Table 3: Optimized Buffer Conditions for SLC30A1 Transport Assays

Assay TypeBuffer CompositionpHTemperatureCritical Considerations
Vesicle transport10 mM HEPES, 150 mM KCl, 5 mM MgCl₂7.437°CPre-incubation with ionophores disrupts vesicle potential
Fluorescent zinc imaging10 mM HEPES, 140 mM NaCl, 5 mM KCl, 1 mM MgCl₂, 2 mM CaCl₂7.222-25°CCalibration with zinc ionophore is essential
Radioactive zinc flux20 mM Mes-Tris, 150 mM KCl, 0.25 M sucrose7.030°CRapid filtration through nitrocellulose membranes
Yeast growth rescueSynthetic defined media with 0.5-2.0 mM ZnCl₂4.5-5.530°CInclude metal chelators (EDTA) in control conditions

The kinetic parameters of SLC30A1 transport are significantly affected by pH, with optimal activity typically observed at physiological pH (7.2-7.4). Temperature sensitivity is also notable, with decreased activity below 25°C. Careful attention to these factors ensures reproducible functional data.

How do post-translational modifications affect Macaca fascicularis SLC30A1 function and how can they be preserved in recombinant systems?

Post-translational modifications (PTMs) critically influence SLC30A1 function through multiple mechanisms. N-linked glycosylation affects protein stability and trafficking to the plasma membrane, while phosphorylation modulates transport activity. Unlike fungal zinc transporters that appear not to be glycosylated based on PNGase F treatment results , mammalian SLC30A1 requires these modifications for optimal function.

To preserve native PTMs in recombinant systems, mammalian expression hosts (HEK293, CHO cells) are strongly recommended. Site-directed mutagenesis of potential glycosylation sites (N to Q mutations) can assess the functional importance of specific modifications. For phosphorylation studies, researchers should consider using phosphomimetic mutations (S/T to D/E) or phospho-null mutations (S/T to A) to investigate regulatory mechanisms.

Table 4: Critical Post-Translational Modifications of SLC30A1

Modification TypeSite(s)Functional ImpactDetection Method
N-glycosylationAsn101, Asn156Membrane trafficking, stabilityPNGase F treatment, lectin blotting
PhosphorylationSer293, Thr295Transport activity regulationPhospho-specific antibodies, mass spectrometry
UbiquitinationLys203, Lys263Protein turnoverUbiquitin pull-down, mass spectrometry
PalmitoylationCys26, Cys29Membrane microdomain localizationClick chemistry with palmitate analogs

Preserving PTMs requires careful selection of cell lysis buffers (containing phosphatase and protease inhibitors) and gentle purification techniques. For structural studies, detergent selection is critical—mild detergents like DDM and LMNG better preserve native protein conformations and modifications compared to more harsh detergents.

How can mutations in recombinant Macaca fascicularis SLC30A1 be used to understand zinc transport mechanisms?

Strategic mutations in recombinant Macaca fascicularis SLC30A1 provide valuable insights into transport mechanisms and structure-function relationships. Conserved residues in the transmembrane domains, particularly histidine and aspartic acid residues that coordinate zinc, are primary targets for mutagenesis studies.

The histidine-rich region between transmembrane domains IV and V, similar to the metal binding region found in fungal CDF proteins , is particularly important for zinc coordination. Mutations in this region (H→A substitutions) typically reduce transport activity. Similarly, the conserved HXXXD and DXXXH motifs in transmembrane domains are critical for zinc transport, as demonstrated by the observation that single amino acid substitutions can alter metal specificity in related transporters .

Table 5: Key Mutations and Their Effects on SLC30A1 Function

MutationDomainFunctional EffectResearch Application
H43ATM I70% reduction in transport activityZinc coordination site identification
D52ATM IIComplete loss of transport activityEssential residue for zinc coordination
H106AHis-rich loop40% reduction in transport activitySecondary coordination site
N44ITM IAltered metal specificityMetal selectivity determinant, similar to fungal Zrc1
Y372ATM VIDisrupted oligomerizationProtein-protein interaction surface
S293DCytoplasmic loopConstitutively active transportPhosphorylation regulation

To systematically evaluate mutations, complementary approaches including yeast growth assays in high zinc media, direct transport measurements, and subcellular localization studies should be employed. Mutations affecting trafficking versus transport function can be distinguished by comparing surface expression levels with transport activity.

What are the challenges in studying SLC30A1 oligomerization and strategies to overcome them?

Evidence suggests that SLC30A1, like other zinc transporters, may form oligomeric structures that influence its function. Studies of fungal zinc transporters have indicated potential oligomerization, with protein bands of higher molecular weight than expected appearing in non-denaturing conditions .

Studying SLC30A1 oligomerization presents several challenges. The protein's hydrophobic nature can lead to non-specific aggregation during extraction and purification. Additionally, detergents used for membrane protein solubilization may disrupt native oligomeric states.

Effective strategies to address these challenges include:

  • Crosslinking approaches: Chemical crosslinkers with different arm lengths (DSS, DSG, BMH) can stabilize protein-protein interactions prior to extraction. In-cell crosslinking provides information about native oligomeric states.

  • Non-denaturing extraction: Digitonin and styrene maleic acid lipid particles (SMALPs) preserve native membrane environments and protein-protein interactions better than traditional detergents.

  • Förster resonance energy transfer (FRET): Expressing SLC30A1 tagged with different fluorophores (CFP/YFP pairs) allows detection of protein proximity within 10nm, indicative of oligomerization.

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS): This technique determines absolute molecular mass independent of shape, allowing accurate determination of oligomeric states.

Similar to observations with fungal Zrc1, which showed evidence of oligomerization that was disrupted by treatment with reducing agents , researchers should carefully consider the use of reducing agents in their extraction buffers when studying SLC30A1 oligomerization.

How can researchers investigate the interactions between SLC30A1 and other zinc homeostasis proteins?

Understanding the functional interactome of SLC30A1 is essential for elucidating its role in cellular zinc homeostasis networks. SLC30A1 interacts with multiple partners including metallothioneins, other zinc transporters, and regulatory proteins.

Proximity-dependent biotin identification (BioID) has emerged as a powerful technique for identifying protein interactions in their native cellular environment. Fusion of SLC30A1 with a promiscuous biotin ligase (BirA*) results in biotinylation of proximal proteins, which can be purified and identified by mass spectrometry. This approach has advantages over traditional co-immunoprecipitation methods for membrane proteins like SLC30A1.

Table 6: Methods for Investigating SLC30A1 Protein Interactions

TechniqueAdvantagesLimitationsNotable Findings
BioIDIn vivo detection, captures transient interactionsRequires genetic fusion, spatial resolution ~10nmIdentified interactions with ER-Golgi trafficking proteins
Co-immunoprecipitationDirect physical interactions, antibody-basedMembrane protein solubilization challengesConfirmed interaction with metallothionein
FRETLive cell imaging, spatial and temporal resolutionLimited to fluorophore-tagged proteinsDemonstrated zinc-dependent association with ZIP7
Split-ubiquitin yeast two-hybridSpecific for membrane proteinsArtificial yeast environmentRevealed oligomerization interfaces
Surface plasmon resonanceQuantitative kinetics and affinityRequires purified proteinsMeasured binding affinity to metallothionein (Kd = 1.7 μM)

Functional validation of protein interactions can be performed through co-expression studies, analyzing how potential interacting partners affect SLC30A1 localization, stability, and transport activity. Co-localization studies using confocal microscopy with spectrally distinct fluorophores provide spatial evidence for interactions.

What are common challenges in expressing recombinant Macaca fascicularis SLC30A1 and how can they be addressed?

Researchers frequently encounter several challenges when expressing recombinant Macaca fascicularis SLC30A1. As a multi-pass membrane protein, SLC30A1 can cause cellular toxicity when overexpressed, leading to low yields and poor cell viability. Additionally, improper folding and aggregation often result in non-functional protein.

To address these issues, several strategies have proven effective:

  • Inducible expression systems (tetracycline-regulated, cumate-inducible) allow tight control over expression levels, reducing toxicity. For mammalian cells, the Flp-In T-REx system provides consistent, moderate expression from a single genomic integration site.

  • Fusion partners that enhance folding and trafficking, such as Mistic or GFP, can improve functional expression. The GFP fusion approach has the added benefit of allowing direct visualization of expression and localization, similar to how researchers visualized Zrc1-GFP localization to the vacuolar membrane in fungi .

  • Growth at reduced temperatures (30°C for mammalian cells, 16°C for E. coli) slows protein synthesis, allowing more time for proper folding and reducing aggregation.

  • Supplementing growth media with zinc (1-5 μM) can stabilize the recombinant protein, though careful titration is necessary as excess zinc becomes toxic, particularly in cells overexpressing a zinc transporter.

When protein extraction is the goal, careful selection of detergents is crucial. DDM (n-dodecyl-β-D-maltoside) at 1% has proven effective for initial solubilization, followed by reduction to 0.1% for subsequent purification steps to maintain protein stability.

How can researchers distinguish between technical artifacts and true functional characteristics when studying SLC30A1?

Distinguishing between artifacts and true functional characteristics requires careful experimental design with appropriate controls. When studying recombinant Macaca fascicularis SLC30A1, several validation approaches should be employed.

For transport activity assays, researchers should include:

  • Transport-deficient mutants (D52A) as negative controls

  • Non-transfected cells to establish baseline transport

  • Specific inhibitors of zinc transport where available

  • Alternative metal ions to confirm specificity

For localization studies, comparison between different tagging strategies (N-terminal vs. C-terminal tags) helps identify artifacts caused by tag interference with trafficking signals. Complementary approaches such as surface biotinylation, protease protection assays, and subcellular fractionation provide independent confirmation of localization data.

What strategies can researchers employ to improve the crystallization of recombinant Macaca fascicularis SLC30A1 for structural studies?

Crystallization of membrane proteins like SLC30A1 presents significant challenges, including conformational heterogeneity, detergent interference, and limited polar surfaces for crystal contacts. Researchers can employ several strategies to improve crystallization success:

Table 7: Recommended Detergents for SLC30A1 Crystallization Trials

DetergentCritical Micelle ConcentrationOptimal Concentration for CrystallizationNotable Properties
DDM0.17 mM0.03-0.05%Good for initial extraction, large micelle
LMNG0.01 mM0.005-0.01%Enhanced stability, smaller micelle than DDM
UDM0.59 mM0.1-0.2%Intermediate micelle size
Cymal-60.56 mM0.1-0.3%Good for crystal formation
CHAPSO8 mM0.4-0.6%Compatible with LCP crystallization

Successful crystallization typically requires screening hundreds of conditions with multiple protein constructs and detergent combinations. High-throughput approaches using robotic systems allow efficient exploration of this parameter space.

How does Macaca fascicularis SLC30A1 function compare to zinc transporters in other model organisms?

Comparative analysis of zinc transporters across species reveals important evolutionary adaptations in zinc homeostasis mechanisms. Macaca fascicularis SLC30A1 represents a mammalian zinc efflux transporter that shares functional similarities with transporters from diverse organisms while displaying unique regulatory features.

A notable difference emerges in expression regulation. Fungal Zrc1 shows increased expression under zinc-limited conditions and decreased expression with zinc addition , whereas mammalian SLC30A1 typically displays the opposite pattern—increased expression under elevated zinc conditions. This reflects their different cellular roles, with Zrc1 working coordinately with high-affinity zinc importers to maintain zinc homeostasis .

Interestingly, both transporters appear to form oligomeric structures, though potentially through different mechanisms. While fungal Zrc1 oligomerization may involve disulfide bonds based on its sensitivity to reducing agents , mammalian SLC30A1 oligomerization appears to involve both disulfide-dependent and independent interactions.

What insights from SLC30A1 research could be applied to understanding zinc-related pathologies?

Research on Macaca fascicularis SLC30A1 provides valuable insights for understanding human zinc-related pathologies due to the high conservation between primate zinc transporters. Dysregulation of zinc homeostasis contributes to numerous conditions including neurodegenerative diseases, diabetes, cancer, and immune dysfunction.

Mutations in human SLC30A1 have been associated with transient neonatal zinc deficiency, highlighting its importance in maintaining proper zinc levels. By studying structure-function relationships in the macaque ortholog, researchers can better understand how specific domains contribute to transport function and how their disruption leads to disease.

The observation that SLC30A1 works in concert with other zinc homeostasis proteins suggests that therapeutic approaches may need to target multiple components of the zinc regulatory network. Similar to how fungal Zrc1 functions coordinately with high-affinity zinc importers , mammalian SLC30A1 likely operates within a complex network of transporters and zinc-binding proteins.

Drug development targeting SLC30A1 or its regulatory pathways could potentially address conditions of zinc dyshomeostasis. Compounds that modulate SLC30A1 transport activity or expression could help restore proper zinc balance in cells affected by either zinc deficiency or toxicity.

What are promising techniques for real-time monitoring of SLC30A1 transport activity in live cells?

Emerging technologies offer exciting possibilities for monitoring SLC30A1 transport activity with unprecedented spatial and temporal resolution. Several promising approaches deserve consideration:

  • Genetically encoded zinc sensors: Fluorescent proteins engineered with zinc-binding domains (ZapCY, eCALWY) allow real-time visualization of zinc flux. These can be targeted to specific subcellular compartments to monitor zinc movement across membranes mediated by SLC30A1. Next-generation sensors with improved dynamic range and faster kinetics will enhance detection sensitivity.

  • Zinc-responsive transcriptional reporters: Synthetic biology approaches using zinc-responsive promoters driving fluorescent or luminescent reporters provide indirect measurement of zinc transport activity. These systems amplify the signal, making them sensitive to subtle changes in transport activity.

  • Electrophysiological approaches: Patch-clamp techniques can detect zinc-dependent currents in cells expressing SLC30A1, providing direct measurement of transport kinetics with millisecond resolution. This approach can distinguish between different transport mechanisms (e.g., antiport vs. symport).

  • Single-molecule tracking: Quantum dot-labeled SLC30A1 can be tracked in living cells to correlate protein dynamics with transport activity. This approach reveals how transporter mobility and clustering affect function.

Future development of these techniques will likely combine multiple approaches, such as simultaneous electrophysiology and fluorescent zinc imaging, to correlate transporter activity with zinc flux in real-time.

How might CRISPR/Cas9 genome editing be applied to study SLC30A1 function in Macaca fascicularis models?

CRISPR/Cas9 technology offers powerful approaches for manipulating SLC30A1 in Macaca fascicularis cells and potentially in animal models. These techniques can address questions about zinc transporter function that were previously inaccessible.

For cellular studies, CRISPR/Cas9 enables:

  • Precise introduction of tagged versions of SLC30A1 at the endogenous locus, ensuring physiological expression levels

  • Creation of specific point mutations to study structure-function relationships

  • Conditional knockout systems using Cre-loxP or similar approaches

  • CRISPRi/CRISPRa systems for reversible modulation of gene expression

For potential animal models, CRISPR/Cas9 could generate:

  • Reporter macaques with fluorescently tagged SLC30A1 for in vivo imaging

  • Models with tissue-specific SLC30A1 deletion to study organ-specific zinc homeostasis

  • Humanized SLC30A1 macaques to better model human zinc transport

Ethical considerations and regulatory requirements must be carefully addressed when designing such studies, particularly for primate models. Cell-based approaches using macaque primary cells or induced pluripotent stem cells (iPSCs) differentiated into relevant cell types may provide valuable insights while minimizing animal use.

The application of these advanced genetic tools to study zinc transporters represents a significant advancement compared to traditional approaches used in earlier studies of fungal zinc transporters , enabling more precise manipulation of endogenous proteins rather than relying solely on overexpression systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.