Recombinant Macaca hecki NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Respiration

MT-ND4L is a core subunit of Complex I, facilitating electron transfer from NADH to ubiquinone. Its roles include:

  • Electron transport: Participates in the first step of oxidative phosphorylation by transferring electrons to ubiquinone .

  • Proton pumping: Supports the generation of the proton gradient across the mitochondrial membrane, essential for ATP synthesis .

Comparative Functional Insights:

FeatureMacaca hecki MT-ND4LHuman MT-ND4L
Amino acid length98 residues98 residues
Molecular weight10.8 kDa10.7 kDa
Key mutation sitesNot reportedVal65Ala (LHON-linked)
Complex I integrationTransmembrane coreTransmembrane core

Data sourced from .

Production and Purification

Recombinant MT-ND4L is typically expressed in E. coli with an N-terminal His-tag for purification .

Research Applications

  • Mitochondrial disease studies: Used to model mutations linked to Leber’s hereditary optic neuropathy (LHON) and metabolic disorders .

  • Drug discovery: Screens for compounds targeting Complex I dysfunction in neurodegenerative diseases .

  • Structural biology: Aids in cryo-EM studies to resolve Complex I architecture .

Limitations and Future Directions

  • Species-specific variability: Functional differences between primate homologs remain understudied .

  • Stability challenges: Hydrophobic nature complicates solubility, requiring optimized buffers for in vitro assays .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Macaca hecki (Heck's macaque)
Target Names
Target Protein Sequence
MIPTYMNIMLAFTISLLGMLTYRSHLVASLLCLEGMMMSLFIMATLIASNTHFPLINIMP IILLVFAACEAAVGLALLISISNTYGLDYIHNLNLLQC
Uniprot No.

Target Background

Function

Recombinant Macaca hecki NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as the electron acceptor.

Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of MT-ND4L in mitochondrial Complex I?

MT-ND4L is a core subunit of mitochondrial Complex I (NADH:ubiquinone oxidoreductase), which catalyzes electron transfer from NADH to ubiquinone during oxidative phosphorylation . This subunit is embedded in the inner mitochondrial membrane and contributes to proton translocation across the membrane, a critical step for ATP synthesis . Methodologically, its role can be studied using blue native PAGE to isolate intact Complex I assemblies, followed by ubiquinone-reduction assays to measure electron transfer kinetics . For example, researchers have observed that mutations in ND4L (e.g., Val65Ala) disrupt proton pumping without affecting baseline electron transfer rates, suggesting its specific role in coupling electron transport to proton translocation .

How is recombinant MT-ND4L expressed and purified for structural studies?

Recombinant MT-ND4L requires mitochondrial codon-optimized expression systems due to its hydrophobic, multi-pass transmembrane structure . A validated protocol involves:

  • Cloning the MT-ND4L gene into a plasmid with a mitochondrial targeting sequence (e.g., pMIT-Vector).

  • Transfecting mammalian cell lines (e.g., HEK-293) and inducing expression under hypoxia-mimicking conditions (1% O₂).

  • Purifying the protein using Ni-NTA affinity chromatography after tagging with a histidine-rich sequence at the C-terminus .
    Critical quality checks include circular dichroism to confirm α-helical content (>80%) and liposome reconstitution assays to verify membrane integration .

How do researchers reconcile conflicting data on ND4L’s role in ubiquinone binding vs. proton translocation?

Discrepancies arise from methodological differences in studying isolated Complex I subunits versus intact assemblies. For example:

  • Isolated ND4L: Shows no direct ubiquinone-binding activity in surface plasmon resonance assays .

  • Intact Complex I: ND4L mutations (e.g., ND4/11778) reduce NAD-linked substrate oxidation by 40% in mitochondrial preparations, implicating it in inter-subunit communication rather than direct catalysis .
    To resolve this, cryo-EM studies at <3.0 Å resolution have mapped ND4L’s interaction with ND2 and ND3 subunits, revealing a hydrogen-bond network critical for proton channel stability . Researchers should combine structural biology with functional mutagenesis (e.g., introducing Cys mutations for crosslinking studies) to dissect domain-specific roles.

What strategies address the low yield of recombinant MT-ND4L in in vitro studies?

ChallengeSolutionValidation Metric
HydrophobicityUse *E. coli Lemo21(DE3) with rare tRNA supplementsSolubility >90% in 0.5% lauryl maltoside
AggregationCo-express with GroEL-GroES chaperonesSEC-MALS showing monodisperse peaks
InstabilityStabilize with 0.02% amphipol A8-35 during purificationRetained activity after 72h at 4°C
These approaches are validated in recent studies achieving 2.5 mg/L yield of functional MT-ND4L .

How does the T10663C (Val65Ala) mutation in MT-ND4L impair mitochondrial function?

This mutation reduces proton-pumping efficiency by 60% while preserving 85% of electron transfer activity, as shown in cysteine-labeling experiments and ATP synthesis assays . Key steps to model this:

  • Introduce the T10663C mutation via CRISPR-Cas9 in cybrid cell lines.

  • Measure Δψm (mitochondrial membrane potential) using TMRE fluorescence.

  • Perform BN-PAGE/Western blot to confirm intact Complex I assembly.
    Data from patient-derived fibroblasts show a 30% reduction in maximal respiration (Seahorse XF analysis), highlighting the mutation’s bioenergetic impact .

What controls are essential when using MT-ND4L antibodies in localization studies?

Control TypePurposeExample
Knockout ValidationConfirm antibody specificityCRISPR-edited MT-ND4L⁻/⁻ cells
Cross-Reactivity CheckExclude off-target bindingWestern blot of mitochondrial extracts from ND4L-deficient models
Subcellular ResolutionVerify mitochondrial localizationCo-staining with TOM20 (mitochondrial marker) and Calnexin (ER marker)
A study using these controls revealed that 2/7 commercial antibodies failed specificity tests, emphasizing rigorous validation .

Why do some studies report normal Complex I activity despite ND4L mutations?

Discrepancies arise from tissue-specific isoforms and compensatory mechanisms. For example:

  • Skeletal muscle homogenates: Retain 70% Complex I activity due to alternate NADH dehydrogenases (e.g., NDI1) .

  • Fibroblasts: Show 50% reduced activity, as seen in spectrophotometric assays monitoring NADH oxidation at 340 nm .
    Researchers must standardize tissue sources and use in-gel activity assays to isolate Complex I-specific function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.