Recombinant Macaca mulatta Tumor necrosis factor (TNF)

Shipped with Ice Packs
In Stock

Description

Table 1: Key Production Metrics

ParameterValueSource
Expression SystemE. coli M15
Yield20–30 mg/L (unmodified)
Purity>95% (SDS-PAGE)
Endotoxin Levels<1.0 EU/μg

Biological Activity and Mechanisms

rmTNF-α exhibits potent cytotoxic effects via receptor binding (TNFR1/TNFR2), triggering apoptosis or necroptosis . Key findings include:

  • Cytotoxicity: ED<sub>50</sub> values of 0.05–0.1 ng/mL in L929 murine fibroblasts and human cancer cells (breast, lung, liver) .

  • Cross-Reactivity: Binds human TNF-α neutralizing agents (e.g., soluble receptors, antibodies) , facilitating preclinical drug testing.

  • Stability: Retains activity after lyophilization and reconstitution in PBS .

Pharmacokinetics and Toxicology

In rhesus macaques, rmTNF-α demonstrates dose-dependent pharmacokinetics:

  • Half-Life: 1.2–2.1 hours at high doses (≥54 μg/kg) .

  • Elimination: Saturable mechanisms at low doses, with >96.3% excreted in urine/feces within 24 hours .

  • Toxicity: Safe at 4×10<sup>6</sup> IU/kg/day for 60 days, though liver toxicity and antibody formation require monitoring .

Table 2: Pharmacokinetic Profile

Dose (μg/kg)Administration RouteHalf-Life (h)Clearance Mechanism
10–30Short-term IVNon-linearSaturable receptor-mediated
≥54Long-term IV1.2–2.1First-order elimination

Applications in Biomedical Research

rmTNF-α is pivotal in:

  • Autoimmune Disease Models: Evaluating anti-TNF therapies for rheumatoid arthritis and psoriasis .

  • Cancer Research: Inducing apoptosis in xenograft models .

  • Inflammation Studies: Simulating septic shock or preterm labor in nonhuman primates .

Comparative Analysis with Human TNF-α

FeaturermTNF-αHuman TNF-α
Molecular Weight17.3 kDa17 kDa (monomer)
SolubilityHigher at low temperatures Prone to precipitation
Apoptotic EfficacyIC<sub>50</sub> 2–3× lower Standard activity

Future Research Directions

  • Clinical Translation: Optimizing systemic delivery for cancer therapy .

  • Structural Studies: Resolving receptor-binding dynamics via cryo-EM .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TNF; TNFA; TNFSF2; Tumor necrosis factor; Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2; TNF-a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-233
Protein Length
full length protein
Species
Macaca mulatta (Rhesus macaque)
Target Names
TNF
Target Protein Sequence
MSTESMIRDVELAEEALPRKTAGPQGSRRCWFLSLFSFLLVAGATTLFCLLHFGVIGPQREEFPKDPSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELTDNQLVVPSEGLYLIYSQVLFKGQGCPSNHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL
Uniprot No.

Target Background

Function

Tumor necrosis factor (TNF) is a cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. Primarily secreted by macrophages, it can induce apoptosis in certain tumor cell lines. A potent pyrogen, it induces fever directly or by stimulating interleukin-1 secretion and is implicated in cachexia. Under specific conditions, it can stimulate cell proliferation and differentiation. It induces insulin resistance in adipocytes by inhibiting insulin-induced IRS1 tyrosine phosphorylation and glucose uptake. Furthermore, it induces GKAP42 protein degradation in adipocytes, partially contributing to TNF-induced insulin resistance. TNF plays a role in angiogenesis by synergistically inducing VEGF production with IL1B and IL6. The intracellular domain (ICD) form of TNF induces IL12 production in dendritic cells.

Gene References Into Functions
  1. These interactions lead to activation of the TNF signaling pathway, apoptosis induction, and DNA damage stress response. PMID: 24743303
  2. Studies indicate that mucosal compartments contain similar percentages of memory CD4(+) T cells and exhibit comparable TNF-alpha cytokine responses to mitogenic stimulation before infection. PMID: 24610016
  3. IL-1beta and TNF-alpha play a primary role in triggering preterm labor associated with inflammation or infection. PMID: 17132473
Database Links
Protein Families
Tumor necrosis factor family
Subcellular Location
Cell membrane; Single-pass type II membrane protein.; [Tumor necrosis factor, membrane form]: Membrane; Single-pass type II membrane protein.; [Tumor necrosis factor, soluble form]: Secreted.; [C-domain 1]: Secreted.; [C-domain 2]: Secreted.

Q&A

What is Macaca mulatta TNF-alpha and how does it differ from human TNF-alpha?

Macaca mulatta (rhesus macaque) TNF-alpha (mmTNF-α) is a bioactive cytokine that functions similarly to human TNF-alpha (hTNF-α) but has species-specific structural differences. The functional extracellular domain of mmTNF-α differs from that of hTNF-α at four amino acid positions . Despite these differences, mmTNF-α forms functional trimers and demonstrates excellent cytotoxicity with an ED50 of 0.05-0.1 ng/ml in standard L929 cell assays, comparable to human TNF-α . Both native-like and SUMO-modified recombinant mmTNF-α exhibit cytotoxicity in human cancer cell lines, including breast, lung, and liver cancer cells . Importantly, human TNF-α neutralizing agents, including soluble receptors and antibodies, have been shown to cross-react with mmTNF-α, highlighting structural conservation of key epitopes between the species .

How is recombinant Macaca mulatta TNF-alpha typically produced for research applications?

Recombinant mmTNF-α can be produced using several expression systems, with E. coli being the most common. One effective approach utilizes a small ubiquitin-like modifier (SUMO) fusion system to enhance protein solubility and yield . The process involves:

  • Insertion of a synthetic gene encoding SUMO-mmTNF-α fusion protein into an expression vector (e.g., pQE30)

  • Transformation into E. coli (e.g., M15 strain)

  • Induction of protein expression

  • Purification of the fusion protein from the soluble fraction

  • Cleavage with SUMO protease to produce native-like mmTNF-α

This method yields approximately 10-12 mg of SUMO-mmTNF-α from 1 L of bacterial culture . Notably, the recombinant protein can be expressed in both soluble and insoluble forms, with the soluble fraction being preferred for functional studies. For commercial preparations, the protein is typically provided as a lyophilized product from a 0.2 μm filtered solution in PBS, either with or without bovine serum albumin (BSA) as a carrier protein .

What reconstitution and storage conditions are optimal for maintaining mmTNF-α activity?

Based on established protocols for recombinant mmTNF-α:

  • Reconstitution:

    • With carrier: Reconstitute at 100 μg/mL in sterile PBS containing at least 0.1% human or bovine serum albumin

    • Carrier-free: Reconstitute at 100 μg/mL in sterile PBS

  • Storage:

    • Use a manual defrost freezer

    • Avoid repeated freeze-thaw cycles

    • Store immediately upon receipt at recommended temperatures

For experimental applications, it's important to note that mmTNF-α has better solubility than hTNF-α at low temperatures. While cooling solutions from room temperature to 0°C induces considerable precipitation of hTNF-α, mmTNF-α remains soluble . Additionally, mmTNF-α demonstrates greater resistance to N-bromosuccinimide (NBS)-induced precipitation compared to hTNF-α, suggesting enhanced stability under certain chemical conditions .

What are the key structural properties of recombinant mmTNF-α that affect its bioactivity?

While denatured mmTNF-α and hTNF-α show similar molecular weights on SDS-PAGE, their native forms exhibit important structural differences :

  • Size: Size-exclusion chromatography and dynamic light scattering (DLS) analyses demonstrate that native mmTNF-α has a smaller molecular size than native hTNF-α .

  • Solubility: mmTNF-α exhibits superior solubility at low temperatures compared to hTNF-α, with minimal precipitation when cooled from room temperature to 0°C .

  • Stability: mmTNF-α shows greater resistance to chemical precipitation agents such as N-bromosuccinimide (NBS) .

  • Receptor binding: Although mmTNF-α and hTNF-α display comparable nanomolar affinities for human death receptors, the mmTNF-α-receptor complex demonstrates a slower dissociation rate, indicating greater stability of the complex .

  • Functional domain: The functional extracellular domain of mmTNF-α (Val77-Leu233) contains the critical regions necessary for proper trimerization and receptor binding .

These structural characteristics contribute to mmTNF-α's ability to induce caspase-dependent apoptosis in human tumor cells with an IC50 that is two to three times lower than that of hTNF-α, suggesting potentially greater potency in certain experimental systems .

How do genetic polymorphisms in the TNF-α promoter affect its expression and function in macaques?

Genetic variation in the TNF-α promoter region plays a significant role in modulating TNF-α expression and disease susceptibility. Key findings include:

  • Extensive polymorphism: Sequence analysis of the TNF-α promoter region in 40 macaques (including M. mulatta and M. fascicularis) revealed 14 single nucleotide polymorphisms (SNPs), 5 of which were newly described, and 20 unique haplotypes .

  • Species-specific variation: While both M. mulatta and M. fascicularis exhibit high genetic variability at the TNF-α promoter, two of the most common haplotypes (representing 31.7% of observed variation) and three potentially functional polymorphisms at positions -781, -535, and -10 were exclusive to M. fascicularis .

  • Transcription factor binding: The TFSEARCH program analysis indicated that these polymorphisms could influence transcription factor binding, potentially affecting TNF-α expression levels .

  • Cross-species comparison: Interestingly, polymorphisms in the human TNF-α promoter associated with malaria susceptibility were not shared with macaques, suggesting species-specific evolution of TNF-α regulation .

  • Population structure: AMOVA analysis and FST values indicated that most variation is shared between species and among populations, suggesting that TNF-α promoter variability predates species divergence .

These genetic variations may impact experimental outcomes when using different macaque populations in research, particularly in infectious disease models such as malaria where TNF-α plays a crucial immunoregulatory role.

How is recombinant mmTNF-α utilized in infectious disease research models?

Recombinant mmTNF-α serves as a valuable tool in various infectious disease research models, particularly:

  • Ebola virus research: Rhesus macaques are used to evaluate supportive care regimens after viral exposure, where TNF-α plays a significant role in the pathogenesis. In these models, intensive supportive care including antibiotics and corticosteroids attempts to modulate the inflammatory response mediated partially by TNF-α .

  • Malaria studies: Macaques exhibit differences in susceptibility to severe malaria upon infection with Plasmodium parasites, with TNF-α playing a critical role in this variability. The TNF-α genetic variation among macaque populations makes them valuable for studying infection outcomes and immunological responses .

  • Immunological assays: mmTNF-α is used to measure the functional capability of natural killer (NK) cell subsets in rhesus macaques. Panels have been developed to determine the frequency of cytokine-secreting and cytotoxic NK cell subpopulations in peripheral blood mononuclear cell samples stimulated in vitro .

  • Preterm labor models: Intraamniotic infusions of TNF-α have been used to study inflammatory mechanisms in preterm labor models using Macaca mulatta .

When designing these studies, researchers should consider species-specific TNF-α variants to ensure physiologically relevant responses, particularly when evaluating immunomodulatory interventions or therapeutic agents.

What methodological approaches are recommended for assessing mmTNF-α functionality?

To accurately assess mmTNF-α functionality in research applications, several methodological approaches are recommended:

  • Cytotoxicity assays:

    • L929 cell assay: The standard for determining TNF-α bioactivity with ED50 values of 0.05-0.1 ng/ml for functional mmTNF-α

    • Human cancer cell lines: Breast, lung, and liver cancer cells can be used to assess cross-species cytotoxic activity

  • Receptor binding assays:

    • Measure binding kinetics (association and dissociation rates) to death receptors

    • Compare with human TNF-α as a reference standard

    • Note that mmTNF-α-receptor complexes typically show slower dissociation rates than hTNF-α-receptor complexes

  • Structural characterization:

    • Size-exclusion chromatography to confirm proper trimerization

    • Dynamic light scattering (DLS) to assess molecular size distribution

    • SDS-PAGE for purity assessment under reducing conditions

  • Biological response evaluation:

    • Caspase activation assays to confirm apoptosis induction

    • Cytokine production in responsive cell types

    • In vivo tumor suppression in xenograft models (e.g., COLO205 xenografts)

  • NK cell functional analysis:

    • Flow cytometry panels including markers for KIRs (Mamu-KIR3DL01 and Mamu-KIR3DL05)

    • Differentiation antigens (CD16 and CD56)

    • Measurement of cytokine secretion and cytotoxicity in stimulated PBMCs

These complementary approaches provide a comprehensive assessment of recombinant mmTNF-α functionality across multiple parameters.

What are the key considerations when using mmTNF-α as an immunoassay standard?

When using recombinant mmTNF-α as an immunoassay standard, researchers should consider:

  • Formulation selection:

    • With carrier protein (BSA): Recommended for cell/tissue culture or as ELISA standard

    • Carrier-free: Preferred for applications where BSA might interfere with results

  • Calibration considerations:

    • Establish species-specific standard curves

    • Account for potential differences in antibody recognition between human and macaque TNF-α

    • Validate cross-reactivity of detection antibodies

  • Reconstitution protocol:

    • Follow manufacturer's recommendations (typically 100 μg/mL in sterile PBS)

    • For carrier protein formulations, reconstitute in buffer containing at least 0.1% human or bovine serum albumin

    • Prepare fresh dilutions for standard curves to ensure accuracy

  • Storage stability:

    • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

    • Monitor lot-to-lot variability in bioactivity

    • Consider mmTNF-α's superior stability at low temperatures compared to hTNF-α when designing protocols

  • Assay validation:

    • Confirm linear range of detection

    • Establish limits of detection specific to mmTNF-α

    • Validate parallelism between standard curve and biological samples

These considerations help ensure accurate quantification and interpretation of results when using mmTNF-α as a reference standard in research applications.

How do mmTNF-α and hTNF-α compare in terms of receptor binding kinetics and downstream signaling?

Although mmTNF-α and hTNF-α share significant homology, their receptor interactions and downstream effects exhibit important differences:

  • Receptor affinity: Both mmTNF-α and hTNF-α show comparable nanomolar affinities for human death receptors, indicating conserved binding domains .

  • Binding stability: The mmTNF-α-receptor complex demonstrates a slower dissociation rate than the hTNF-α-receptor complex, suggesting greater stability once bound .

  • Cytotoxic potency: mmTNF-α induces caspase-dependent apoptosis in human tumor cells with an IC50 that is two to three times lower than that of hTNF-α, indicating potentially enhanced potency in certain cellular contexts .

  • Cross-reactivity with neutralizing agents: Human TNF-α neutralizing agents, including soluble receptors and antibodies, interact with mmTNF-α, confirming structural conservation of key epitopes .

  • In vivo efficacy: Despite differences in in vitro potency, mmTNF-α and hTNF-α demonstrate similar levels of tumor suppression in mouse models bearing COLO205 xenografts, suggesting potential compensatory mechanisms in vivo .

These findings highlight the importance of selecting the appropriate species-specific TNF-α variant for research questions, particularly when studying receptor-mediated signaling pathways or testing TNF-α-targeting therapeutics.

What strategies are recommended for optimizing the production of high-yield, bioactive mmTNF-α?

For researchers seeking to produce high-yield, bioactive mmTNF-α, several optimization strategies are recommended:

  • Expression system selection:

    • SUMO fusion system: Enhances protein solubility and yield, producing approximately 10-12 mg of SUMO-mmTNF-α from 1 L of bacterial culture

    • E. coli strains: M15 strain has been successfully used with pQE30 plasmid

    • Consider codon optimization for the expression host

  • Protein solubility enhancement:

    • The SUMO tag significantly improves solubility during expression

    • mmTNF-α naturally demonstrates better solubility than hTNF-α at low temperatures

    • Optimize buffer conditions to maintain solubility throughout purification

  • Purification considerations:

    • Isolate from soluble fraction after cell lysis

    • Use affinity chromatography for initial capture

    • Apply size-exclusion chromatography to ensure proper trimerization

    • Consider the superior resistance of mmTNF-α to precipitation when designing purification strategies

  • Functional validation:

    • Confirm bioactivity using L929 cytotoxicity assay (ED50 0.05-0.1 ng/ml)

    • Verify proper trimerization by size-exclusion chromatography

    • Test receptor binding and cellular responses

  • Storage optimization:

    • Lyophilize from a 0.2 μm filtered solution in PBS

    • Consider adding carrier protein (BSA) for long-term stability

    • Store in aliquots to avoid freeze-thaw cycles

These strategies collectively enable the production of high-quality mmTNF-α for research applications, taking advantage of its naturally enhanced stability characteristics compared to hTNF-α.

How can genetic variation in TNF-α be addressed when designing macaque-based disease models?

When designing macaque-based disease models that involve TNF-α-mediated pathways, researchers should consider genetic variation through the following approaches:

  • Genetic screening:

    • Sequence the TNF-α promoter region of study animals to identify relevant polymorphisms

    • Categorize animals based on haplotype patterns, particularly focusing on functionally significant variants at positions -781, -535, and -10

  • Population selection:

    • Consider geographic origin when selecting macaques, as M. fascicularis from different regions (Malaysian, Mauritian, Indonesian, Philippine) may exhibit distinct TNF-α genetic profiles

    • Be aware that Chinese and Indian ancestry M. mulatta may have different TNF-α promoter variants

  • Experimental design considerations:

    • Stratify treatment groups based on TNF-α promoter haplotypes

    • Include sufficient animals from each relevant genetic background

    • Consider potential confounding from linkage to other immune genes

  • Data analysis strategy:

    • Incorporate TNF-α genotype as a variable in statistical analyses

    • Evaluate whether responses correlate with specific promoter polymorphisms

    • Compare results across different macaque populations to identify consistent patterns

  • Translational implications:

    • Note that polymorphisms in the human TNF-α promoter associated with malaria susceptibility are not shared with macaques

    • Consider species-specific TNF-α regulation when extrapolating results to human disease

This approach acknowledges that while macaques are frequently used as models for human diseases, the genetic architecture underlying TNF-α expression exhibits important species-specific features that must be accounted for in experimental design and interpretation.

How does the emergence of SUMO-modified mmTNF-α impact experimental applications?

The development of SUMO-modified mmTNF-α represents a significant technological advancement with several experimental implications:

  • Enhanced production efficiency:

    • SUMO-mmTNF-α expression yields approximately 10-12 mg from 1 L of bacterial culture

    • This represents a two-fold increase compared to conventional hTNF-α production methods

  • Dual functionality:

    • Both SUMO-modified and native-like mmTNF-α (after SUMO protease cleavage) form functional trimers

    • Both forms show excellent cytotoxicity in standard L929 cells (ED50 0.05-0.1 ng/ml)

  • Extended experimental applications:

    • SUMO-mmTNF-α remains bioactive, allowing its direct use without cleavage

    • This simplifies experimental protocols and reduces processing steps

    • Both forms exhibit cytotoxicity in human cancer cell types (breast, lung, liver)

  • Cross-species utility:

    • SUMO-mmTNF-α interacts with human TNF-α neutralizing agents, including soluble receptors and antibodies

    • This enables in vitro preclinical evaluation of biological hTNF-α neutralizing therapeutics

  • Future applications:

    • The SUMO fusion system could be applied to other cytokines and species-specific variants

    • The approach may enable better comparative studies between human and non-human primate immune responses

    • The technology could facilitate development of improved rhesus macaque models for human autoimmune diseases

This technological advancement expands the toolkit available for researchers working with macaque models, particularly for evaluating novel human TNF-α neutralizing agents and studying TNF-α-related pathogenesis.

What are the current limitations in mmTNF-α research and potential solutions?

Despite significant advances, several limitations remain in mmTNF-α research that require innovative solutions:

  • Genetic heterogeneity:

    • Current challenge: The high degree of genetic variability at the TNF-α promoter (14 SNPs and 20 unique haplotypes) complicates standardization across studies

    • Potential solution: Development of comprehensive genetic screening panels for macaque research colonies and reporting of TNF-α haplotypes in publications

  • Receptor interaction characterization:

    • Current challenge: Limited detailed understanding of mmTNF-α interactions with specific receptor subtypes compared to human TNF-α

    • Potential solution: Structural biology approaches (e.g., cryo-EM) to elucidate mmTNF-α-receptor complexes and comparative binding studies

  • Functional assay standardization:

    • Current challenge: Variability in cytotoxicity and bioactivity assays across laboratories

    • Potential solution: Development of reference standards and standardized protocols specifically for mmTNF-α functional assessment

  • In vivo translation:

    • Current challenge: Despite greater in vitro potency, mmTNF-α shows similar in vivo tumor suppression to hTNF-α in xenograft models

    • Potential solution: Development of macaque-specific tumor models and improved methods to study pharmacokinetics/pharmacodynamics

  • Commercial availability:

    • Current challenge: Limited variety of recombinant mmTNF-α products compared to human counterparts

    • Potential solution: Expanded production of variant forms (trimeric, monomeric, membrane-bound) for specialized applications

Addressing these limitations will require collaborative efforts between immunologists, protein biochemists, and macaque model specialists to advance the field and improve the translational relevance of mmTNF-α research.

How can mmTNF-α be utilized to advance understanding of species-specific immune responses?

Recombinant mmTNF-α offers unique opportunities to explore species-specific immune responses:

  • Comparative immunology:

    • Compare cellular responses to human versus macaque TNF-α in identical experimental systems

    • Investigate evolutionary conservation and divergence in TNF signaling pathways

    • Identify species-specific adaptations in immune regulation

  • Cross-reactivity studies:

    • Evaluate binding of therapeutic TNF-α antagonists to mmTNF-α

    • Assess neutralization efficiency across species

    • Identify conserved epitopes for next-generation therapeutic development

  • Disease model refinement:

    • Use mmTNF-α to develop more physiologically relevant macaque models of inflammatory diseases

    • Study TNF-α-dependent pathologies in a species-matched context

    • Improve translational relevance of preclinical studies

  • Receptor biology:

    • Explore differences in receptor binding kinetics between human and macaque TNF-α

    • Investigate the functional consequences of the more stable mmTNF-α-receptor complex

    • Map species-specific variations in downstream signaling pathways

  • NK cell functionality:

    • Utilize mmTNF-α to assess natural killer cell subsets in macaques

    • Evaluate cytokine secretion and cytotoxicity in stimulated peripheral blood mononuclear cells

    • Compare NK cell responses across different macaque populations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.