Recombinant Macaca mulatta ATP-binding cassette sub-family G member 2 (ABCG2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Macaca mulatta ABCG2

ABCG2 is a member of the ATP-binding cassette (ABC) transporter superfamily, known for its role in effluxing xenobiotics, chemotherapeutic agents, and endogenous compounds like urate . The recombinant Macaca mulatta variant shares 94% amino acid sequence identity with human ABCG2, making it a valuable model for translational studies . Its structural and functional conservation enables researchers to investigate drug resistance, placental barrier functions, and urate metabolism in primates .

Table 1: Key Studies Utilizing Recombinant Macaca mulatta ABCG2

Study FocusModel/SystemMajor FindingsCitation
Drug ResistanceCancer cell linesABCG2 overexpression confers resistance to Aurora kinase inhibitor GSK1070916
Blood-Brain BarrierNHP PET imagingDual ABCB1/ABCG2 inhibition increases brain penetration of [11C]erlotinib
Urate TransportHyperuricemia modelsABCG2 dysfunction linked to elevated serum urate levels in primates
Substrate SpecificityATPase assaysBinds mitoxantrone, anthracyclines, and urate with high affinity

Pharmacological and Clinical Insights

  • Drug Resistance Modulation: Co-administration of ABCG2 inhibitors (e.g., Ko143) reverses resistance to chemotherapeutics like topotecan and methotrexate .

  • BBB Penetration Enhancement: In NHPs, dual inhibition with erlotinib and tariquidar increased brain uptake of [11C]erlotinib by 3.4–5.0-fold, demonstrating ABCG2’s role in limiting CNS drug delivery .

  • Urate Excretion: Polymorphisms in ABCG2 correlate with hyperuricemia and gout risk, validated in primate models .

Genetic and Molecular Insights

  • Conserved Function: Macaca mulatta ABCG2 retains substrate specificity for urate and chemotherapeutics, mirroring human pathophysiology .

  • Regulatory Pathways: Expression is modulated by HIF-2α, Wnt/β-catenin, and inflammatory cytokines in disease states .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ABCG2; Broad substrate specificity ATP-binding cassette transporter ABCG2; ATP-binding cassette sub-family G member 2; Urate exporter; CD antigen CD338
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-654
Protein Length
full length protein
Species
Macaca mulatta (Rhesus macaque)
Target Names
Target Protein Sequence
MSSSNVEVFIPMSQENTNGFPTTTSNDRKAFTEGAVLSFHNICYRVKVKSGFLPGRKPVE KEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPSGLSGDVLINGALRPTNFKCN SGYVVQDDVVMGTLTVRENLQFSAALRLPTTMTNHEKNERINRVIQELGLDKVADSKVGT QFIRGVSGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIF SIHQPRYSIFKLFDSLTLLASGRLMFHGPAQEALGYFESAGYHCEAYNNPADFFLDIING DSTAVALNREEDFKATEIIEPSKRDKPLVEKLAEIYVDSSFYKETKAELHQLSGGEKKKI TVFKEISYTTSFCHQLRWVSKRSFKNLLGNPQASIAQIIVTVILGLVIGAIYFGLNNDST GIQNRAGVLFFLTTNQCFSSVSAVELFVVEKKLFIHEYISGYYRVSSYFFGKLLSDLLPM RMLPSIIFTCIVYFMLGLKPTADAFFIMMFTLMMVAYSASSMALAIAAGQSVVSVATLLM TICFVFMMIFSGLLVNLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATVNN TCNYATCTGEEYLAKQGIDLSPWGLWKNHVALACMIVIFLTIAYLKLLFLKKYS
Uniprot No.

Target Background

Function
Recombinant Macaca mulatta ATP-binding cassette sub-family G member 2 (ABCG2) is a broad-substrate specificity, ATP-dependent transporter belonging to the ATP-binding cassette (ABC) family. It actively extrudes a diverse range of physiological compounds, dietary toxins, and xenobiotics from cells. Its functions include porphyrin homeostasis (mediating protoporphyrin IX (PPIX) export from mitochondria to cytosol and cytosol to extracellular space), heme export, sphingosine-1-P efflux, and urate export in both renal and extrarenal tissues. In the kidney, it also functions as a physiological exporter of the uremic toxin indoxyl sulfate. Additional substrates include steroids such as estrone 3-sulfate (E1S) and 3β-sulfooxy-androst-5-en-17-one (DHEAS), and other sulfate conjugates. ABCG2 also mediates riboflavin and biotin secretion into milk, pheophorbide a efflux (reducing phototoxicity), and xenobiotic exclusion from the brain. It confers multidrug resistance to cells by controlling the efflux of compounds such as mitoxantrone, pheophorbide, camptothecin, methotrexate, azidothymidine, daunorubicin, and doxorubicin. In the placenta, it limits drug penetration from maternal plasma to the fetus. ABCG2 may also contribute to early stem cell self-renewal by inhibiting differentiation.
Database Links
Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein. Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Macaca mulatta ABCG2 and why is it important in translational research?

Macaca mulatta (rhesus macaque) ABCG2 is a member of the ATP-binding cassette (ABC) transporter superfamily that functions as a xenobiotic transporter. It plays significant roles in:

  • Conferring the side population (SP) phenotype through efflux of Hoechst 33342 dye

  • Drug resistance mechanisms involving mitoxantrone and anthracycline compounds

  • Hematopoietic stem cell function and enrichment

  • Cellular defense against toxic compounds

The importance of Macaca mulatta ABCG2 in translational research stems from the evolutionary closeness of rhesus macaques to humans. Studies show that cynomolgus macaque ABC transporters, including ABCG2, share 96-98% sequence identity with their human orthologs at the amino acid level, making them excellent models for preclinical studies of drug metabolism and transport . Research involving rhesus macaque ABCG2 provides critical insights applicable to human drug development and toxicology studies with greater translational relevance than rodent models.

How does the amino acid sequence of Macaca mulatta ABCG2 compare to human ABCG2?

Comparative analysis of Macaca mulatta ABCG2 and human ABCG2 reveals:

FeatureComparison Details
Sequence Identity96-98% amino acid sequence identity
Phylogenetic ClusteringMost closely clustered with human ortholog by phylogenetic analysis
Gene StructureSimilar gene structures and genomic organization in cynomolgus macaques and humans
Functional ConservationShared functional characteristics including drug efflux capabilities and SP phenotype induction

This high degree of sequence similarity supports the use of recombinant Macaca mulatta ABCG2 as a relevant model for human ABCG2 in preclinical studies, particularly for evaluating drug interactions and transport mechanisms before advancing to human trials.

What are the typical expression patterns of ABCG2 in Macaca mulatta tissues?

ABCG2 demonstrates distinct tissue expression patterns in Macaca mulatta, which have been analyzed using quantitative polymerase chain reaction. The expression profile shows:

  • Highest expression in jejunum (intestine)

  • Significant expression in liver

  • Moderate expression in kidney

  • Similar tissue distribution pattern to human ABCG2

This expression pattern aligns with the role of ABCG2 in drug absorption, distribution, metabolism, and excretion (ADME) processes. The highest expression in intestinal tissue suggests a critical role in limiting oral bioavailability of substrate drugs, similar to its function in humans.

What are the recommended methods for cloning and expressing recombinant Macaca mulatta ABCG2?

Based on successful approaches documented in the literature, the following methodology is recommended:

Cloning Strategy:

  • Isolate full-length rhesus ABCG2 from appropriate tissue sources (e.g., liver, intestine)

  • Utilize retroviral vector systems for efficient gene delivery and expression

  • Incorporate appropriate tagging systems (e.g., His-tag) for purification and detection

Expression Systems:

  • E. coli expression: Suitable for producing partial ABCG2 domains for structural studies but may require optimization for proper folding

  • Mammalian cell expression: Preferred for functional studies as it allows proper post-translational modifications and membrane insertion

  • Retroviral transduction: Effective for studying ABCG2 function in hematopoietic cells

For example, one successful approach involved cloning full-length rhesus ABCG2 and introducing it into a retroviral vector for transduction of peripheral blood progenitor cells (PBPCs) . This method allowed for functional analysis of ABCG2 activity through monitoring of the SP phenotype and protection against mitoxantrone.

How can researchers verify the functionality of recombinant Macaca mulatta ABCG2?

Several complementary approaches can be used to verify both expression and functionality:

Expression Verification:

  • Western blot analysis using anti-ABCG2 antibodies

  • Flow cytometry for cell surface expression (when expressed in intact cells)

  • qPCR for mRNA expression levels

Functional Verification:

  • SP phenotype assay: Measure efflux of Hoechst 33342 dye in cells expressing ABCG2 compared to controls

    • Cells with active ABCG2 will show reduced dye accumulation

    • This can be quantified by flow cytometry

  • Drug resistance assay: Test for selective protection against mitoxantrone

    • ABCG2-transduced cells should show increased survival when exposed to mitoxantrone

    • In vitro studies have demonstrated this protective effect in ABCG2-transduced rhesus PBPCs

  • Transport assays: Measure the transport of known ABCG2 substrates across membranes

These functional assays provide a comprehensive verification of proper ABCG2 expression and activity before proceeding with more complex experiments.

What are the critical parameters for maintaining stability of recombinant Macaca mulatta ABCG2 in experimental settings?

Based on protocols established for similar recombinant proteins, the following parameters are critical:

Storage Conditions:

  • Store at -80°C for long-term (12 months) stability

  • Avoid repeated freeze/thaw cycles

  • For short-term (one month) storage, 2-8°C is suitable

Buffer Composition:

  • Optimal buffer composition includes:

    • 100mM NaHCO₃

    • 500mM NaCl

    • pH 8.3

    • 1mM EDTA

    • 1mM DTT

    • 0.01% sarcosyl

    • 5% Trehalose as a stabilizer

Reconstitution Protocols:

  • Reconstitute in appropriate buffer (e.g., 100mM NaHCO₃, 500mM NaCl, pH 8.3)

  • Aim for a concentration of 0.1-1.0 mg/mL

  • Avoid vortexing to prevent protein denaturation

Stability Monitoring:

  • Accelerated thermal degradation testing (e.g., 37°C for 48h) can be used to evaluate stability

  • Loss rate should be less than 5% within the expiration date under appropriate storage conditions

How does ABCG2 overexpression affect hematopoietic differentiation in Macaca mulatta compared to murine models?

This question addresses an important discrepancy between species in ABCG2 function:

Species Differences:

  • Murine studies suggest that forced ABCG2 expression prevents hematopoietic differentiation

  • Macaca mulatta studies show no such inhibition of differentiation in vivo

Experimental Evidence:
In a key study with rhesus macaques:

  • Two animals received autologous PBPCs split for transduction with ABCG2 or control vectors

  • Marking levels were similar between fractions with no discrepancy between bone marrow and peripheral blood marking

  • Analysis for the SP phenotype among bone marrow and mature blood populations confirmed ABCG2 expression at levels predicted by vector copy number long-term

  • This demonstrated no block to differentiation in the large animal model

This interspecies difference has important implications for gene therapy applications, suggesting that results from murine models may not accurately predict outcomes in primates and humans when considering ABCG2-based interventions.

What role does ABCG2 play in regulating autophagy in Macaca mulatta cells?

ABCG2 has functions beyond drug transport, including regulation of autophagy, which affects cell survival under stress conditions:

Key Findings:

  • ABCG2 expression enhances/accelerates autophagy induced by various stressors

  • This enhanced autophagy results in delayed cell death and enhanced cell survival

  • ABCG2-expressing cells exhibit higher basal autophagy activity than their parent cell lines

  • Under amino acid starvation, ABCG2 expression is associated with:

    • Higher accumulation of LC3-II (autophagosome marker)

    • More rapid and robust autophagy response when lysosomal degradation is inhibited

    • Higher autophagy flux as measured by tandem-fluorescence-tagged LC3 assays

Methodological Approach:

  • Use GFP-LC3 puncta assays to visualize autophagosome formation

  • Employ western blot analysis of LC3-II accumulation

  • Apply lysosomal inhibitors like bafilomycin A₁ to measure autophagy flux

  • Compare autophagy activity between ABCG2-expressing and control cells under stress conditions like amino acid starvation

This autophagy-enhancing function of ABCG2 may have significant implications for cell survival in therapeutic contexts and drug resistance mechanisms in cancer cells.

How can recombinant Macaca mulatta ABCG2 be utilized as an in vivo selection marker for gene therapy applications?

Research suggests promising applications for ABCG2 in gene therapy strategies:

Mechanism and Rationale:

  • ABCG2 expression confers the SP phenotype and provides protection against certain cytotoxic drugs

  • This protective effect can be exploited as a selection strategy in gene therapy applications

  • Cells transduced with therapeutic genes coupled with ABCG2 can be selected for in vivo using appropriate drug regimens

Experimental Support:

  • In vitro studies showed selective protection against mitoxantrone among ABCG2-transduced rhesus PBPCs

  • Long-term expression of ABCG2 was maintained in rhesus macaques without detrimental effects on differentiation

  • These findings imply a potential role for ABCG2 overexpression as an in vivo selection strategy for gene therapy applications

Methodological Approach:

  • Co-express ABCG2 with the therapeutic gene of interest

  • Administer selection drugs (e.g., mitoxantrone) that preferentially allow ABCG2-expressing cells to survive

  • Monitor engraftment and persistence of gene-modified cells through tracking of ABCG2 expression or the SP phenotype

This approach could enhance the efficacy of gene therapy by enriching for cells carrying the therapeutic transgene through drug selection pressure.

What are the differences in drug substrate specificity between Macaca mulatta ABCG2 and human ABCG2?

Understanding substrate specificity differences is crucial for translational research:

Comparative Analysis:

  • Despite high sequence similarity (96-98%), subtle amino acid differences may affect substrate specificity

  • Cross-reactivity studies with related transporters like GMCSF receptors suggest functional conservation between macaque and human proteins

Experimental Approaches to Determine Specificity:

  • Transport assays with fluorescent substrates (e.g., Hoechst 33342, mitoxantrone)

  • Drug resistance profiles comparing cell survival in the presence of various cytotoxic agents

  • Co-immunoprecipitation experiments to assess interaction with binding partners and substrates

  • Structural modeling to identify key amino acid differences in substrate binding regions

Research Implications:

  • When evaluating novel drugs in rhesus macaque models, researchers should consider potential differences in ABCG2 substrate specificity

  • Validation experiments should be conducted to confirm that findings in macaque models accurately predict human ABCG2 interactions

  • Similar approaches to those used in comparing mmGMCSF with human GMCSF could be applied to ABCG2

What controls should be included when studying recombinant Macaca mulatta ABCG2 function in cellular systems?

Proper experimental design requires comprehensive controls:

Essential Controls:

  • Vector-only control: Cells transduced with empty vector to control for effects of the vector itself

    • Essential for distinguishing ABCG2-specific effects from vector-induced changes

  • Wild-type vs. mutant ABCG2:

    • Include non-functional mutant ABCG2 (e.g., mutations in ATP-binding domain)

    • Helps distinguish between transport-dependent and transport-independent effects

  • Pharmacological inhibition:

    • Include conditions with specific ABCG2 inhibitors

    • Confirms that observed effects are due to ABCG2 transport activity

  • Dose dependence:

    • Test multiple expression levels of ABCG2

    • Important for identifying potential threshold effects

  • Temporal controls:

    • Monitor expression and function over time

    • Essential for long-term studies as shown in rhesus macaque studies where ABCG2 expression was maintained long-term

Implementing these controls helps ensure that observed phenotypes are specifically attributable to Macaca mulatta ABCG2 function rather than experimental artifacts or secondary effects.

How can researchers develop a reliable quantitative assay for evaluating Macaca mulatta ABCG2 transport activity?

A robust quantitative assay requires careful optimization of several parameters:

Assay Development Framework:

  • Substrate Selection:

    • Choose appropriate fluorescent substrates (e.g., Hoechst 33342, BODIPY-prazosin)

    • Consider multiple substrates to comprehensively characterize transport activity

  • Measurement Methods:

    • Flow cytometry for cellular accumulation/efflux assays

    • Confocal microscopy for visualizing substrate distribution

    • Plate reader-based assays for high-throughput screening

  • Kinetic Parameters:

    • Determine Km and Vmax for various substrates

    • Assess competitive and non-competitive inhibition patterns

  • Standardization Protocol:

    1. Establish stable cell lines with defined ABCG2 expression levels

    2. Normalize transport activity to expression level

    3. Include reference inhibitors at standardized concentrations

    4. Develop a calibration curve relating transport activity to ABCG2 expression

  • Validation Steps:

    • Confirm specificity through inhibitor studies

    • Perform parallel assays with human ABCG2 for comparison

    • Assess reproducibility across different experimental conditions

This methodical approach ensures development of a reliable quantitative assay that can accurately measure Macaca mulatta ABCG2 transport activity for research applications.

How can recombinant Macaca mulatta ABCG2 be used to predict drug interactions in human clinical trials?

Recombinant Macaca mulatta ABCG2 offers valuable tools for predicting drug interactions:

Translational Research Strategy:

  • In Vitro Screening:

    • Test new drug candidates for interaction with recombinant Macaca mulatta ABCG2

    • Compare results with human ABCG2 to identify potential species differences

    • Use transport assays and ATPase activity measurements to characterize interactions

  • Pharmacokinetic Modeling:

    • Incorporate ABCG2 interaction data into physiologically-based pharmacokinetic models

    • Predict tissue distribution and drug-drug interactions

    • Account for species differences when extrapolating to humans

  • Preclinical to Clinical Translation:

    • Use Macaca mulatta ABCG2 data as an intermediate step between rodent and human studies

    • The high sequence similarity (96-98%) with human ABCG2 makes rhesus macaque studies highly relevant for human predictions

    • Similar approaches have been successfully applied with other transporters like mmGMCSF

  • Validation Approach:

    • Test predictions in rhesus macaque models before human trials

    • Correlate in vitro findings with in vivo pharmacokinetics

    • Use biomarkers of ABCG2 activity to monitor drug interactions

This approach leverages the evolutionary closeness of rhesus macaques to humans to provide more reliable predictions of drug interactions involving ABCG2 transporters.

What are the methodological considerations for studying ABCG2's role in the blood-brain barrier of Macaca mulatta?

ABCG2 plays a critical role in the blood-brain barrier (BBB), affecting drug penetration into the CNS:

Methodological Framework:

  • Cell Type Considerations:

    • Study ABCG2 in all relevant BBB cell types, including:

      • Endothelial cells (primary site of BBB function)

      • Astrocytes (contribute to BBB integrity)

      • Pericytes (regulate BBB properties)

    • Research has shown that all BBB cells possess drug metabolizing and transporting capabilities

  • Ex Vivo and In Vitro Approaches:

    • Primary cell isolation: Obtain primary BBB cells from Macaca mulatta brain tissue

    • Cell culture models: Establish transwell cultures to model the BBB

    • Drug transport assays: Measure substrate movement across BBB models

  • In Vivo Methodologies:

    • PET imaging with ABCG2 substrates to assess BBB function

    • CSF sampling to measure drug concentrations

    • Brain tissue analysis to quantify drug penetration

  • Disease State Considerations:

    • The BBB is a dynamic, pharmacologically active microenvironment that responds differentially to disease

    • Studies show that the BBB responds to disease and CNS small molecule therapeutics in a cell-dependent manner

    • Consider how pathological conditions affect ABCG2 expression and function

  • Analytical Techniques:

    • Use LC-MS/MS to quantify drug concentrations in different brain regions

    • Apply proteomics by mass spectrometry to assess ABCG2 expression levels

    • Conduct functional assays to evaluate transport activity

This comprehensive approach accounts for the complexity of the BBB and provides a framework for understanding ABCG2's role in drug disposition in the CNS.

How should researchers interpret differences in experimental results between recombinant Macaca mulatta ABCG2 and human ABCG2 studies?

When faced with discrepancies between species, consider the following analytical framework:

Systematic Analysis Approach:

  • Source of Variation Assessment:

    • Sequence differences: Despite high similarity (96-98%), key amino acid variations may affect function

    • Post-translational modifications: Differences in glycosylation or phosphorylation patterns

    • Experimental conditions: Variations in assay conditions, expression systems, or cell types

    • Interaction partners: Differences in regulatory proteins or membrane composition

  • Functional Domain Analysis:

    • Map variations to specific functional domains (e.g., ATP-binding, substrate binding)

    • Analyze effects on:

      • Transport kinetics (Km, Vmax)

      • Substrate specificity

      • Regulatory mechanisms

  • Translation to Human Context:

    • Develop a decision tree for determining relevance to human ABCG2 function:

      • If differences occur in highly conserved regions: likely relevant to humans

      • If differences occur in variable regions: may represent species-specific adaptations

      • If differences are quantitative rather than qualitative: adjust scaling factors accordingly

  • Validation Strategy:

    • When differences are observed, validate with multiple approaches:

      • Test in different expression systems

      • Use site-directed mutagenesis to identify critical residues

      • Compare with other primate species if possible

This systematic approach helps determine whether observed differences represent true biological variations or experimental artifacts, guiding appropriate translation to human applications.

What statistical approaches are most appropriate for analyzing transport kinetics data from Macaca mulatta ABCG2 studies?

Robust statistical analysis is essential for interpreting transport data:

Statistical Framework:

  • Kinetic Parameter Estimation:

    • Use nonlinear regression to determine Michaelis-Menten parameters (Km, Vmax)

    • Apply Eadie-Hofstee or Lineweaver-Burk transformations to identify deviations from classical kinetics

    • Consider global fitting approaches for complex transport mechanisms

  • Comparative Statistical Methods:

    • For comparing Macaca mulatta vs. human ABCG2:

      • Analysis of covariance (ANCOVA) to compare regression slopes

      • Extra sum-of-squares F test to determine if datasets can be fit with shared parameters

      • Bootstrap resampling to establish confidence intervals for parameter differences

  • Experimental Design Considerations:

    • Power analysis to determine sample size requirements

    • Nested experimental designs to account for biological and technical variability

    • Factorial designs to evaluate multiple factors simultaneously

  • Advanced Approaches for Complex Data:

    • Mixed-effects modeling for longitudinal studies

    • Bayesian methods for incorporating prior knowledge

    • Machine learning approaches for identifying patterns in large datasets

  • Reporting Standards:

    • Report all parameters with appropriate confidence intervals

    • Include goodness-of-fit metrics (R², residual plots)

    • Provide raw data or accessible repositories when possible

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.