Recombinant Macaca mulatta Bombesin receptor subtype-3 (BRS3)

Shipped with Ice Packs
In Stock

Description

Protein Identification

Recombinant Macaca mulatta Bombesin receptor subtype-3 is identified by the Uniprot number Q6H2Y3 and is classified as a transmembrane protein . The protein derived from Macaca mulatta (Rhesus macaque) is a full-length protein spanning amino acid positions 1-398 . As a member of the bombesin receptor family, BRS3 functions as a G protein-coupled receptor with specific bombesin receptor activity .

Production Tags and Modifications

The recombinant protein is typically produced with an N-terminal 10xHis-tag, which facilitates purification and detection in research applications . This modification does not significantly alter the protein's biological properties but enhances its utility in laboratory settings. The tag type may vary depending on the specific production process employed for different research applications .

Expression Systems

Expression SystemProduct Code ExampleCharacteristics
E. coliCSB-CF740142MOWMost common, full-length protein
YeastCSB-YP740142MOW1Often used for partial protein expression
BaculovirusCSB-BP740142MOW1Insect cell-based expression
Mammalian cellCSB-MP740142MOW1Closest to native post-translational modifications
In Vivo Biotinylation in E. coliCSB-EP740142MOW1-BContains biotinylation for detection applications

This diversity of expression systems provides researchers with options to select the most appropriate form of the recombinant protein based on their specific experimental requirements .

Shelf Life

The stability of recombinant Macaca mulatta BRS3 varies depending on its formulation:

  • Liquid form: Approximately 6 months when stored at -20°C/-80°C

  • Lyophilized form: Up to 12 months when stored at -20°C/-80°C

The shelf life may be influenced by various factors including buffer composition, storage temperature, and the inherent stability characteristics of the protein itself .

Physiological Roles

BRS3 plays crucial roles in multiple physiological processes, particularly in energy metabolism and glucose homeostasis. Research indicates that BRS3 regulates energy homeostasis and is involved in the modulation of glucose-stimulated insulin secretion (GSIS) . This function positions the receptor as a potential therapeutic target for metabolic disorders, particularly obesity .

Signaling Pathways

The bombesin receptor subtype-3 participates in several important signaling cascades, including:

  • RET signaling pathway

  • G protein-coupled receptor (GPCR) signaling

These pathways are essential for intracellular communication and the regulation of diverse cellular functions. The receptor's activity in these signaling networks contributes to its physiological effects on energy metabolism and insulin secretion.

Gene Ontology Classifications

According to Gene Ontology (GO) annotations, BRS3 exhibits specific molecular functions including:

  • G protein-coupled receptor activity

  • Bombesin receptor activity

These functional classifications highlight the protein's role in signal transduction and its specificity for bombesin-like peptides as binding partners.

Disease Associations

Research has linked BRS3 to several pathological conditions, most notably:

  • Lung Cancer

  • Brugada Syndrome 4

These associations suggest potential roles for BRS3 in disease pathogenesis and position it as a possible biomarker or therapeutic target. The relationship between BRS3 dysregulation and these conditions continues to be an active area of investigation.

Therapeutic Potential

BRS3 agonism is being actively explored as a potential therapeutic approach for obesity . This therapeutic strategy aims to leverage the receptor's role in energy homeostasis to develop interventions for weight management. The development of selective BRS3 agonists, such as Bag-1, has facilitated research into the receptor's potential as a drug target .

Available Research Tools

A variety of research reagents related to Macaca mulatta BRS3 are available to support scientific investigation, including:

Reagent TypeApplicationsExamples
Recombinant ProteinsFunctional studies, binding assaysFull-length and partial proteins from various expression systems
AntibodiesWestern blot, immunofluorescence, ELISASpecies-specific antibodies with varied applications
cDNAGene expression studies, cloningSequence-verified cDNA constructs
ELISA KitsQuantitative protein detectionValidated kits for specific detection of BRS3

These tools enable researchers to investigate BRS3 expression, localization, interaction partners, and functional properties in various experimental contexts .

Experimental Relevance

The recombinant Macaca mulatta BRS3 serves as an important tool for comparative studies between primate and human BRS3, given the phylogenetic proximity of rhesus macaques to humans. This protein has been identified in proteomic studies, appearing in comprehensive lists of identified proteins in biomedical research . Its presence in such studies highlights its relevance to broader investigations of receptor biology and physiological regulation.

Cross-Species Comparison

Recombinant BRS3 proteins are available from multiple species, allowing for comparative studies of structure and function:

SpeciesSourceProduct Code ExampleNotes
Macaca mulatta (Rhesus macaque)E. coliCSB-CF740142MOWFull-length protein (1-398)
Rattus norvegicus (Rat)E. coliCSB-CF814322RAUsed in rodent model studies
Homo sapiens (Human)E. coliCSB-CF002820HUCritical for translational research

This cross-species availability facilitates evolutionary studies and translational research, bridging findings between animal models and human applications .

Evolutionary Conservation

BRS3 demonstrates evolutionary conservation across mammals, with the macaque version serving as an important model for understanding the human receptor. GRPR (Gastrin-Releasing Peptide Receptor) represents an important paralog of BRS3, suggesting evolutionary relationships within this receptor family . The conservation of BRS3 across species underscores its fundamental biological importance.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your preferred tag type for prioritized development.
Synonyms
BRS3; Bombesin receptor subtype-3; BRS-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-398
Protein Length
full length protein
Species
Macaca mulatta (Rhesus macaque)
Target Names
Target Protein Sequence
MAQRQPHSPNQTLISITNDTESSSVVSNDNTNKGRSGDNSPGIEALCAIYITYAVIISVG ILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGRIGCK VLSFIRLTSVGVSVFTLTILSADRYKAVVKPLERQPSNAILKTCIKAGCVWIVSMIFALP EAIFSNVYSFRDPNKNVTFESCTSYPVSKKLLQEIHSLLCFLVFYIIPLSIISVYYSLIA RTLYKSTLNIPTEEQGHARKQIESRKRIARTVLVLVALFALCWLPNHLLYLYHSFTSQTY VDPSAMHFIFTIFSRVLAFSNSCVNPFALYWLSKTFQKHFKAQLFCCKAEQPEPPVADTS LTTLAVMGRVPGTGNMQMSEISVTSFPGCSVKQAEDRV
Uniprot No.

Target Background

Function

Role: Involved in sperm cell division, maturation, and function. This receptor functions through G protein association, activating a phosphatidylinositol-calcium second messenger system.

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is BRS3 and why is the Macaca mulatta model significant for research?

BRS3 is an orphan G protein-coupled receptor belonging to the bombesin receptor family. It plays crucial roles in energy homeostasis, glucose regulation, and has been implicated in tumor growth and lung development . The Macaca mulatta model has particular significance because it represents a translational bridge between rodent studies and human applications. Rhesus macaque BRS3 shares high homology with human BRS3, making it valuable for predicting human responses to therapeutic interventions targeting this receptor .

Unlike other bombesin receptors that bind natural bombesin-like peptides (GRP and NMB), BRS3 does not bind any known natural bombesin peptide with high affinity, maintaining its status as an orphan receptor . Knockout studies in mice have demonstrated BRS3's importance in metabolic regulation, highlighting its relevance in physiological processes across species .

How do the expression systems for recombinant Macaca mulatta BRS3 compare?

Multiple expression systems are available for producing recombinant Macaca mulatta BRS3, each with distinct advantages and limitations:

Expression SystemAdvantagesLimitationsApplications
E. coliCost-effective, high yield for partial domainsLimited post-translational modificationsStructural studies of isolated domains
YeastBetter protein folding than bacteriaNon-mammalian glycosylationModerate-scale protein production
BaculovirusSuitable for full-length membrane proteinsMore complex methodologyFunctional studies requiring proper folding
Mammalian cellsNative-like processing, ideal for functional studiesLower yields, higher costSignaling studies, drug screening

For studies involving functional characterization of BRS3 signaling pathways, mammalian expression systems are generally preferred as they provide the cellular environment necessary for proper receptor folding, trafficking, and coupling to G proteins . Commercial sources offer recombinant Macaca mulatta BRS3 produced in various expression systems to meet different research needs .

What are the key pharmacological properties of Macaca mulatta BRS3?

The pharmacological profile of Macaca mulatta BRS3 has several distinctive characteristics:

  • As an orphan receptor, it lacks a known high-affinity endogenous ligand .

  • Several synthetic ligands have been developed that interact with BRS3:

    • Agonists: [D-Tyr6, β-Ala11, Phe13, Nle14]Bn-(6-14) and MK-5046

    • Antagonists: Bantag-1 and ML-18

  • Binding curves for BRS3 ligands are characteristically broad (spanning >4 log units) with Hill coefficients often differing significantly from unity, suggesting complex binding mechanics .

  • The receptor displays evidence of high-affinity and low-affinity binding sites for certain ligands, as demonstrated with MK-5046 which exhibits biphasic binding characteristics (Ki values of approximately 0.08 nM for high-affinity and 11-29 nM for low-affinity sites) .

  • Differences in signaling kinetics exist between peptide and non-peptide agonists, with peptide agonists typically causing more rapid stimulation while non-peptide agonists like MK-5046 often show more prolonged activity .

These pharmacological properties must be carefully considered when designing experiments to evaluate BRS3 function or when screening for novel modulators.

How can researchers effectively study BRS3-mediated signaling pathways?

BRS3 activates multiple signaling pathways that can be studied using various methodological approaches:

  • Primary signaling readouts:

    • Phospholipase C (PLC) activation leading to inositol phosphate accumulation

    • Intracellular calcium mobilization using fluorescent indicators (Fluo-4 AM, Fura-2)

    • MAPK cascade activation, particularly ERK1/2 phosphorylation

  • Secondary signaling pathways:

    • Akt pathway activation

    • Focal adhesion kinase (FAK) and paxillin phosphorylation

    • Phospholipase A2 (PLA2) activation (though this shows partial agonism with some ligands)

When studying these pathways, researchers should consider the following methodological aspects:

  • Time-course experiments are essential as different agonists show distinct kinetics and duration of action

  • Dose-response relationships should be thoroughly characterized due to the biphasic nature of some BRS3 responses

  • Multiple readouts should be assessed, as functional selectivity (biased agonism) has been observed with different ligands

  • Appropriate controls including antagonist studies (e.g., using Bantag-1) are necessary to confirm receptor-specific effects

The non-peptide agonist MK-5046 has been found to function as a full agonist for activation of MAPK, FAK, Akt, and paxillin but acts as a partial agonist for PLA2 activation, highlighting the importance of examining multiple signaling endpoints .

What approaches are recommended for studying BRS3 in metabolic regulation?

BRS3 has important roles in metabolic regulation, particularly in glucose homeostasis and energy balance. Research approaches should include:

  • Pancreatic islet studies:

    • Glucose-stimulated insulin secretion assays with selective BRS3 agonists and antagonists

    • Calcium imaging to assess β-cell activation in response to BRS3 stimulation

    • Gene expression analysis of metabolic targets in islet cells

  • In vivo metabolic assessments:

    • Glucose tolerance tests following BRS3 agonist administration

    • Insulin sensitivity measurements

    • Energy expenditure and food intake monitoring

  • Comparative studies:

    • Species-specific differences between Macaca mulatta, human, and rodent BRS3 function

    • Sex-specific differences in BRS3-mediated metabolic effects

  • Molecular approaches:

    • Receptor knockout or knockdown models

    • Signaling pathway inhibition studies to identify critical mediators

Recent evidence indicates that BRS3 regulates glucose-stimulated insulin secretion in pancreatic islets across multiple species, making this an important area for translational research . When designing these experiments, researchers should consider both the direct effects of BRS3 activation on pancreatic islets and the indirect effects mediated through central nervous system circuits.

What are the optimal controls for validating BRS3 specificity in experimental systems?

Establishing specificity in BRS3 studies requires rigorous controls:

  • Pharmacological controls:

    • Competitive antagonists (e.g., Bantag-1) to block receptor-specific effects

    • Structurally related but inactive compounds to control for non-specific effects

    • Dose-response relationships to demonstrate receptor-mediated responses

    • Comparison with other bombesin receptor (GRP-R, NMB-R) selective ligands to confirm subtype specificity

  • Molecular controls:

    • BRS3 knockdown or knockout systems

    • Expression of mutant receptors with impaired signaling

    • Heterologous expression systems with defined receptor content

  • Cell/tissue controls:

    • Cell lines lacking endogenous BRS3 expression

    • Comparison across tissues with different BRS3 expression levels

    • Species-matched experimental systems

  • Signaling pathway controls:

    • G-protein inhibitors (e.g., pertussis toxin for Gi/o)

    • PLC inhibitors for Gq-mediated pathways

    • Parallel assessment of multiple signaling outputs

The specificity of BRS3-mediated effects should be demonstrated through convergent evidence from multiple control approaches rather than relying on a single specificity control.

How should researchers interpret differences in BRS3 ligand responses across study systems?

Differences in BRS3 responses across experimental systems may arise from several factors that require systematic analysis:

  • Expression level variations:

    • Receptor density affects apparent potency and efficacy

    • Excessive overexpression may lead to constitutive activity

    • Low expression may obscure partial agonist effects

  • Signaling context differences:

    • G-protein expression profiles vary across cell types

    • Scaffold proteins and regulatory molecules differ between systems

    • Receptor coupling efficiency can vary with cellular context

  • Methodological considerations:

    • Assay sensitivity and dynamic range limitations

    • Temporal aspects of measurements (kinetic differences)

    • Buffer composition and experimental conditions

  • Ligand-specific factors:

    • Stability and solubility in different experimental media

    • Off-target activities at different receptor concentrations

    • Complex pharmacology with multiple binding sites

To address these challenges, researchers should:

  • Quantify receptor expression levels across systems

  • Conduct parallel experiments in different cell backgrounds

  • Use multiple, complementary assay readouts

  • Perform full concentration-response analyses rather than single-point measurements

The broad binding curves and complex pharmacology reported for BRS3 highlight the importance of comprehensive pharmacological characterization in any new experimental system .

What quality control measures are essential for recombinant BRS3 preparations?

Quality control for recombinant Macaca mulatta BRS3 preparations should assess:

  • Purity and integrity:

    • SDS-PAGE analysis with appropriate protein staining

    • Western blotting with specific anti-BRS3 antibodies

    • Mass spectrometry verification of intact protein mass

    • N-terminal sequencing to confirm protein identity

  • Functional activity:

    • Ligand binding assays using known synthetic ligands (e.g., MK-5046)

    • G-protein coupling assessment

    • Signaling activation upon stimulation with known agonists

  • For membrane preparations:

    • Membrane marker enzyme assays

    • Microscopy to assess membrane quality and homogeneity

    • Stability under storage conditions

  • For purified protein:

    • Assessment of aggregation state by size exclusion chromatography

    • Thermal stability analysis

    • Verification of post-translational modifications if relevant

Standardized quality control protocols should be established and consistently applied to ensure reproducibility across experiments. Commercial antibodies are available for BRS3 detection in quality control workflows .

How can researchers overcome challenges in studying an orphan receptor like BRS3?

The orphan status of BRS3 presents unique challenges that can be addressed through:

  • Synthetic ligand utilization:

    • Well-characterized agonists like MK-5046 or [D-Tyr6, β-Ala11, Phe13, Nle14]Bn-(6-14)

    • Selective antagonists such as Bantag-1

    • Development of labeled derivatives for binding studies

  • Alternative activation assessment approaches:

    • Constitutive activity measurement if present

    • Chimeric receptor construction with known ligand binding domains

    • Receptor mutagenesis to identify key functional residues

  • Unbiased screening strategies:

    • Cell-based phenotypic screens to identify novel activators

    • Tissue extract fractionation to search for endogenous ligands

    • In silico screening based on receptor structure models

  • Physiological context studies:

    • Examination of receptor regulation under various conditions

    • Identification of factors that modulate BRS3 expression or activity

    • Comparative studies across species to identify conserved regulatory mechanisms

The development of multiple selective, high-affinity BRS3 agonists and antagonists has significantly advanced our understanding of this receptor despite its orphan status . Using these tools in combination with modern genomic and proteomic approaches provides multiple avenues to overcome the challenges of studying an orphan receptor.

What are effective strategies for optimizing BRS3 expression in recombinant systems?

Optimizing BRS3 expression requires addressing several common challenges:

  • Vector design considerations:

    • Codon optimization for the expression host

    • Inclusion of appropriate signal sequences

    • Addition of tags that enhance expression and detection (e.g., FLAG, HA)

    • Use of strong, tissue-appropriate promoters

  • Expression system selection:

    • Mammalian cells (HEK293, CHO) for functional studies

    • Insect cells/baculovirus for higher yield of functional receptor

    • E. coli for domain-specific studies

  • Culture condition optimization:

    • Temperature modulation during expression

    • Chemical chaperone addition

    • DMSO supplementation to enhance folding

    • Optimized induction protocols

  • Co-expression strategies:

    • G-proteins to stabilize active conformations

    • Receptor activity-modifying proteins (RAMPs)

    • Chaperones to enhance folding and trafficking

When optimizing expression, researchers should confirm that the recombinant receptor retains appropriate pharmacological characteristics, including proper ligand binding properties and signaling capabilities. Various commercial sources offer optimized expression systems for Macaca mulatta BRS3 .

How should researchers analyze complex BRS3 binding and signaling data?

The complex pharmacology of BRS3 requires sophisticated data analysis approaches:

  • Binding data analysis:

    • Evaluation of one-site vs. two-site binding models

    • Assessment of Hill coefficients to detect cooperativity

    • Global fitting of multiple experiments

    • Analysis of kinetic binding parameters

  • Signaling data considerations:

    • Appropriate curve-fitting for biphasic responses

    • Area-under-curve calculations for transient responses

    • Bias factor calculations to quantify pathway selectivity

    • Normalization strategies for comparing across pathways

  • Statistical approaches:

    • ANOVA with appropriate post-hoc tests for multiple comparisons

    • Non-linear regression analysis for concentration-response data

    • Sample size determination through power analysis

    • Assessment of intra- and inter-assay variability

  • Data integration strategies:

    • Correlation analysis between binding and function

    • Principal component analysis for multi-parameter data sets

    • Operational models to derive efficacy parameters

Given the reported biphasic responses and multiple affinity states observed with BRS3 ligands , researchers should avoid simplified analyses that assume standard one-site binding models or monophasic signaling responses. More complex models that account for receptor states, G-protein coupling, and pathway-specific activation are often necessary.

How can BRS3 research contribute to understanding disease mechanisms?

BRS3 has been implicated in several disease processes that represent important research areas:

  • Metabolic disorders:

    • Obesity: BRS3 knockout mice develop obesity, suggesting a role in energy homeostasis

    • Diabetes mellitus: BRS3 regulates glucose-stimulated insulin secretion

    • Metabolic syndrome: Potential integration of multiple metabolic pathways

  • Cancer biology:

    • Lung cancer: BRS3 expression has been detected in lung cancer tissues

    • Tumor growth regulation: Effects on proliferation and survival pathways

    • Potential therapeutic target through selective antagonists

  • Respiratory diseases:

    • Asthma: BRS3 has been implicated in respiratory regulation

    • Inflammatory mechanisms in lung pathology

  • Kidney diseases:

    • Emerging evidence for BRS3 involvement in renal physiology and pathology

  • Neurological functions:

    • BRS3 expression in the central nervous system suggests roles in neuronal regulation

    • Potential implications for feeding behavior and satiety

Research approaches to explore these disease connections should include:

  • Expression profiling in affected tissues

  • Genetic association studies

  • Functional assessment of disease-relevant signaling pathways

  • Preclinical models using selective BRS3 modulators

  • Comparative analysis across species to identify conserved disease mechanisms

What comparative approaches reveal insights about BRS3 function across species?

Comparative studies provide valuable insights into BRS3 biology:

  • Sequence conservation analysis:

    • Identification of highly conserved domains likely essential for function

    • Species-specific variations that may correlate with physiological differences

    • Evolutionary analysis of receptor-ligand co-evolution

  • Pharmacological comparisons:

    • Species-specific differences in ligand binding properties

    • Variations in signaling pathway coupling efficiency

    • Differential responses to synthetic agonists and antagonists

  • Physiological differences:

    • Metabolic effects of BRS3 activation across species

    • Expression pattern variations in different tissues

    • Developmental regulation differences

  • Methodological approaches:

    • Side-by-side testing in multiple species

    • Generation of species-specific tools (antibodies, ligands)

    • Humanized or "macaque-ized" models for translational studies

Comparative studies have revealed that while BRS3 function is largely conserved across mammals, there are important quantitative differences in pharmacological properties and physiological functions . These differences must be considered when extrapolating findings across species, particularly when moving from rodent to primate models or when translating to human applications.

What emerging technologies are advancing BRS3 research?

Several cutting-edge technologies are transforming BRS3 research:

  • Structural biology advances:

    • Cryo-electron microscopy for membrane protein structures

    • Molecular dynamics simulations of receptor-ligand interactions

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • Genetic manipulation tools:

    • CRISPR/Cas9 gene editing for precise receptor modifications

    • Conditional knockout models for tissue-specific studies

    • Single-cell transcriptomics to identify BRS3-expressing cell populations

  • Advanced imaging approaches:

    • Super-resolution microscopy for receptor localization and trafficking

    • Bioluminescence resonance energy transfer (BRET) for protein interactions

    • PET imaging with selective BRS3 radiotracers

  • Drug discovery platforms:

    • Fragment-based drug design for novel ligands

    • Computational screening for new chemotypes

    • Allosteric modulator development

  • Translational research tools:

    • Patient-derived organoids for disease modeling

    • Biomarkers for BRS3 pathway activation

    • Pharmacogenomic approaches to predict treatment responses

These technologies are enabling more precise interrogation of BRS3 biology and accelerating the development of novel therapeutic approaches targeting this receptor system in metabolic diseases and cancer.

What interdisciplinary approaches show promise for advancing BRS3 research?

BRS3 research benefits from integration across multiple disciplines:

  • Molecular pharmacology and structural biology:

    • Detailed characterization of ligand binding mechanisms

    • Structure-based drug design

    • Allosteric modulation exploration

  • Systems biology and physiology:

    • Integration of BRS3 in broader signaling networks

    • Whole-organism physiological responses

    • Mathematical modeling of receptor function in complex systems

  • Computational biology:

    • Predictive modeling of ligand-receptor interactions

    • Network analysis of BRS3-regulated genes

    • Integration of multi-omics data sets

  • Translational medicine:

    • Biomarker development for clinical studies

    • Target validation in disease-relevant models

    • Therapeutic strategy optimization

  • Medicinal chemistry:

    • Design of improved selective ligands

    • Development of tool compounds for research

    • Optimization of drug-like properties

The complex biology of BRS3 and its involvement in multiple physiological systems necessitates these interdisciplinary approaches to fully elucidate its functions and therapeutic potential. Collaborative research integrating expertise across these domains has the greatest potential to advance the field and develop novel therapeutic strategies targeting BRS3.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.