Recombinant Macaca mulatta CXCR2 retains the canonical seven-transmembrane (7TM) topology of GPCRs, with distinct extracellular and intracellular domains. The full-length protein (UniProt ID: Q28519) spans 420 amino acids and includes:
| Domain | Amino Acid Sequence (Partial) | Functional Role |
|---|---|---|
| N-terminal | FNMESDSFEDLWKGEDFSNYSYSSDLPPSLPDVAPCRPESLEINKYF | Ligand recognition and binding |
| Transmembrane 1 | VVIIYALVFLLSLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLF | Anchoring to cell membrane |
| Extracellular Loop 2 | RRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIM | Ligand specificity and signal transduction |
| C-terminal | LISKDSLPKDSRPSFVGSSSGHT | Receptor internalization and recycling |
The recombinant variant expressed in E. coli or mammalian systems typically includes residues 1–353 to enhance solubility while preserving functional epitopes .
CXCR2 binds ELR+ CXC chemokines (e.g., CXCL1, CXCL8/IL-8) through its extracellular N-terminal domain and transmembrane helices. Key findings include:
Affinity Differences: Macaque CXCR2 binds human IL-8 with higher affinity (Kd = 46 pM) compared to human CXCR2 (Kd = 220 pM), but shows reduced affinity for CXCL1 (Kd = 3.7 nM vs. 540 pM in humans) .
Antagonist Sensitivity: The CXCR2-specific antagonist SB225002 exhibits 10-fold lower potency in macaque receptors, suggesting species-specific conformational variations .
Downstream Pathways: Activation triggers Gαi-mediated MAPK, PI3K/AKT, and β-arrestin signaling, driving neutrophil chemotaxis and tumor microenvironment remodeling .
Neutrophil Recruitment: CXCR2 orchestrates neutrophil migration via IL-8 and CXCL1 gradients, with macaque models showing conserved mechanisms for studying human inflammatory diseases .
Receptor Trafficking: Phosphorylation of serine residues in the C-terminus regulates clathrin-mediated internalization, with Rab5 GTPases directing lysosomal degradation or plasma membrane recycling .
Gastric Cancer (GC): CXCR2/STAT3 feed-forward loops in GC cells amplify metastasis by interacting with tumor-associated macrophages (TAMs) secreting CXCL1/CXCL5. Knockdown of CXCR2 reduces lymph node metastasis by 50% in xenograft models .
Therapeutic Targeting: Small-molecule antagonists (e.g., AZD5069) suppress GC growth by disrupting CXCR2-mediated EMT and stromal crosstalk .
Species-Specific Variability: Differences in ligand affinity between human and macaque CXCR2 necessitate careful interpretation of preclinical data .
Biased Signaling: Developing ligands that selectively activate anti-inflammatory pathways (e.g., β-arrestin) without inducing neutropenia remains a priority .
UniGene: Mmu.26899
Macaca mulatta CXCR2 (C-X-C motif chemokine receptor 2) is a protein-coding gene (Entrez Gene ID: 700407) found in rhesus monkeys, also known by synonyms CXC-R2, CXCR-2, and IL8RB. It encodes a G-protein-coupled receptor that functions as a receptor for chemokines, particularly interleukin-8 (IL-8) and growth-regulated oncogene alpha (Gro-alpha) . CXCR2 plays a crucial role in neutrophil chemotaxis following inflammatory stimuli and is highly expressed in blood cells.
Several transcript variants have been identified for this gene, including:
| mRNA | Protein | Name |
|---|---|---|
| XM_015111045.2 | XP_014966531.1 | C-X-C chemokine receptor type 2 |
| XM_015111045.1 | XP_014966531.1 | C-X-C chemokine receptor type 2 |
| XM_028831101.1 | XP_028686934.1 | C-X-C chemokine receptor type 2 |
The cloned ORF sequence is typically 1068bp in length, encoding a protein with the characteristic seven-transmembrane domain structure typical of chemokine receptors . This receptor is involved in inflammatory responses and has been implicated in various pathological conditions including inflammatory diseases and cancer progression .
Key comparative binding affinities:
| Ligand | Monkey CXCR2 Binding Affinity | Human CXCR2 Binding Affinity |
|---|---|---|
| IL-8 | 46 ± 28 pM | 220 ± 14 pM |
| Gro-α | 3.7 ± 2.2 nM | 540 ± 140 pM |
This data indicates that monkey CXCR2 has a higher affinity for IL-8 but a significantly lower affinity for Gro-alpha compared to human CXCR2 . Additionally, pharmacological responses differ; the CXCR2-specific antagonist SB225002 is 10-fold more potent in inhibiting IL-8 binding to human CXCR2 than to monkey CXCR2, suggesting that amino acid sequence differences affect ligand binding sites or receptor conformation .
Despite these differences, both receptors are functionally active in inducing GTPγS exchange on membranes in response to IL-8 and Gro-alpha and in mediating chemotactic activity, confirming their functional homology .
Successful cloning and expression of recombinant Macaca mulatta CXCR2 typically involves the following methodological steps:
mRNA isolation: Extract total RNA from Macaca mulatta blood samples, which express high levels of CXCR2 .
cDNA synthesis: Perform reverse transcription using oligo(dT) primers or random hexamers.
PCR amplification: Design specific primers based on the known Macaca mulatta CXCR2 sequence to amplify the complete coding region.
Cloning into expression vector: Ligate the PCR product into an appropriate mammalian expression vector (e.g., pcDNA3.1-C-(k)DYK) . The ligation reaction typically includes:
PCR product (purified)
Linearized vector
T4 DNA ligase
Ligation buffer
Incubation at 16°C for 10 hours
Transformation: Transform the ligation mixture into competent E. coli cells (e.g., JM109) using heat shock (42°C for 90 seconds) .
Selection and verification: Select ampicillin-resistant colonies, extract plasmid DNA, and verify the insert by sequencing to ensure the correct CXCR2 sequence is present .
Large-scale plasmid preparation: Culture positive clones and extract plasmid DNA using commercial kits (e.g., QIAGEN plasmid plus Giga kit) for transfection experiments .
Expression in mammalian cells: Transfect the verified plasmid into appropriate mammalian cell lines (e.g., BaF3 cells) for functional studies .
Verification of successful expression can be accomplished using Western blotting, flow cytometry, or functional assays such as ligand binding or chemotaxis assays.
Several experimental systems have proven effective for studying Macaca mulatta CXCR2 function:
Recombinant expression systems: Transfected BaF3 cells have been successfully used to express CXCR2 and study its binding properties and signal transduction . These cells provide a clean background for receptor studies as they don't express endogenous chemokine receptors.
Primary neutrophils: Isolated from Macaca mulatta blood, these cells express endogenous CXCR2 and represent a physiologically relevant system for studying natural receptor function.
Reporter cell lines: Cells expressing CXCR2 fused to EGFP (Enhanced Green Fluorescent Protein) allow visualization of receptor localization and trafficking .
Key functional assays include:
Binding assays: Using radiolabeled or fluorescently labeled chemokines to measure receptor-ligand interactions and binding affinities .
GTPγS binding assays: To measure G-protein activation upon receptor stimulation .
Chemotaxis assays: Using Transwell chambers or microfluidic devices to quantify cell migration in response to chemokine gradients .
Calcium mobilization assays: To measure intracellular calcium flux upon receptor activation.
Conjugate formation assays: To assess adhesion properties of cells expressing CXCR2 .
When selecting an experimental system, consider the specific research question and whether native post-translational modifications are critical for your study.
Effective delivery of CXCR2-targeted siRNA requires careful consideration of the delivery vehicle and modifications to enhance stability. A successful approach demonstrated in animal models includes:
siRNA design: Design siRNA sequences specifically targeting conserved regions of CXCR2 mRNA. Multiple siRNA sequences should be tested to identify those with highest knockdown efficiency .
Plasmid-based expression: Clone the siRNA sequence into expression vectors containing RNA polymerase III promoters (e.g., U6 promoter) to drive continuous expression of the siRNA .
Vector selection: The pDC316-EGFP-U6 plasmid has been successfully used, as it contains:
Chemical modifications: To improve in vivo stability, cholesterol modifications can be added to the plasmid using linking agents such as pyrrolidine. The resulting chol-pDC316-EGFP-U6-CXCR2-siRNA shows enhanced stability in the presence of nucleases in tissue and blood .
Delivery methods:
Liposomal transfection for in vitro studies
Liposome-encapsulated delivery for in vivo applications
Direct injection into target tissues
Hydrodynamic delivery for hepatic targeting
Successful knockdown can be verified by monitoring:
EGFP fluorescence to track plasmid expression (reported efficiency of approximately 10%)
Reduction in CXCR2 mRNA levels by RT-qPCR
Decreased CXCR2 protein levels by Western blot or flow cytometry
Functional assays such as reduced chemotaxis in response to CXCR2 ligands
This approach has demonstrated significant effects in animal models of disease, suggesting its potential utility in Macaca mulatta studies .
CXCR2 plays a central role in neutrophil trafficking by mediating chemotaxis in response to CXC chemokines, particularly IL-8 and Gro-alpha. In Macaca mulatta models, this process can be studied using several approaches:
Ex vivo neutrophil isolation and functional assessment:
Isolate neutrophils from Macaca mulatta blood using density gradient centrifugation
Evaluate CXCR2 expression by flow cytometry
Perform Transwell migration assays toward CXCR2 ligands (IL-8, Gro-alpha)
Measure calcium flux in response to ligand stimulation
Assess adhesion molecule expression (CD11b, CD18) after CXCR2 activation
Genetic modification approaches:
In vivo models of inflammation:
Create localized inflammatory responses by injecting CXCR2 ligands
Use intravital microscopy to visualize neutrophil trafficking in real-time
Collect tissue samples to quantify neutrophil infiltration
Apply CXCR2 antagonists to confirm receptor-specific effects
Disease models:
Key techniques for quantifying neutrophil trafficking include flow cytometry of tissue digests, immunohistochemistry, myeloperoxidase assays, and advanced imaging techniques. These approaches have revealed that CXCR2 is essential for neutrophil extravasation from the bloodstream into inflamed tissues, and that targeting CXCR2 can reduce pathological neutrophil infiltration in various disease models .
Species-specific differences in CXCR2 binding and signaling have significant implications for translational studies moving from Macaca mulatta models to human applications:
Ligand binding differences:
Monkey CXCR2 binds IL-8 with higher affinity (46 ± 28 pM) than human CXCR2 (220 ± 14 pM)
Conversely, monkey CXCR2 has substantially lower affinity for Gro-alpha (3.7 ± 2.2 nM) compared to human CXCR2 (540 ± 140 pM)
These differences suggest that the relative importance of different chemokines in vivo may vary between species
Antagonist potency variations:
Structural implications:
Amino acid differences between human and monkey CXCR2 likely affect:
Ligand binding pockets
Receptor conformation
Interaction with intracellular signaling molecules
Molecular modeling can help identify key residues responsible for species differences
Translational considerations:
Efficacy in Macaca mulatta models may not directly predict human efficacy due to receptor differences
Pharmacokinetic/pharmacodynamic relationships established in monkeys require validation in human systems
Target engagement biomarkers should be established that work across species
Recombinant CXCR2 from both human and Macaca mulatta sources plays a crucial role in therapeutic development for inflammatory diseases through several approaches:
High-throughput screening platforms:
Cell lines expressing recombinant CXCR2 enable screening of compound libraries
Parallel screening against human and Macaca mulatta CXCR2 identifies compounds with cross-species activity
Functional readouts include calcium flux, β-arrestin recruitment, and GTPγS binding
Antibody development:
Recombinant CXCR2 serves as an antigen for generating high-affinity antibodies
Picomolar antibodies targeting CXCR2 have shown promise in blocking neutrophil migration
These antibodies compete with natural ligands rather than targeting the ligands themselves, offering a distinct therapeutic approach compared to anti-TNF antibodies
Structure-based drug design:
Structural studies of recombinant CXCR2 guide rational design of antagonists
Comparative analysis of human and Macaca mulatta CXCR2 helps identify conserved binding pockets
In silico screening against receptor models accelerates lead identification
Preclinical validation:
Genetic engineering approaches:
siRNA delivery methods targeting CXCR2 have shown efficacy in animal models
Cholesterol-modified plasmids containing CXCR2-siRNA demonstrate improved stability and delivery
These approaches have successfully reduced symptoms in conditions where inappropriate neutrophil migration contributes to pathology
The development of CXCR2 antagonists has significant therapeutic potential across multiple diseases, including inflammatory conditions and certain cancers where CXCR2 signaling promotes tumor growth and metastasis . Successful development requires accounting for the species-specific differences discussed previously to ensure that efficacy observed in Macaca mulatta models translates effectively to human patients.
Developing specific antagonists for Macaca mulatta CXCR2 requires careful consideration of several factors to ensure efficacy in both experimental models and potential therapeutic applications:
Structural and pharmacological differences:
The 10-fold difference in potency of SB225002 between human and monkey CXCR2 highlights the importance of species-specific testing
Comparative homology modeling of human and Macaca mulatta CXCR2 can identify key structural differences in the binding pocket
Compound libraries should be screened against both receptors to identify molecules with balanced activity
Binding mode characterization:
Determine whether compounds bind competitively with IL-8, Gro-alpha, or both
Evaluate allosteric modulators that may have different effects on various ligand interactions
Consider the potential for biased antagonism affecting specific signaling pathways
Pharmacokinetic considerations:
Optimize compounds for appropriate half-life in Macaca mulatta
Consider blood-brain barrier penetration if targeting neuroinflammatory conditions
Evaluate routes of administration suitable for long-term studies
Selectivity profiling:
Test against related chemokine receptors (especially CXCR1) to ensure specificity
Evaluate potential off-target effects on other GPCRs
Assess effects on other species' CXCR2 receptors if comparative studies are planned
Functional validation:
Confirm that binding translates to functional antagonism in cellular assays
Evaluate effects on multiple downstream pathways:
G-protein activation
β-arrestin recruitment
ERK phosphorylation
Chemotaxis inhibition
In vivo validation approaches:
Establish PK/PD relationships in Macaca mulatta
Develop target engagement biomarkers (e.g., ex vivo chemotaxis assays with blood neutrophils)
Test in relevant disease models where CXCR2 plays a key role
By addressing these considerations, researchers can develop antagonists that effectively target Macaca mulatta CXCR2 for research applications while also providing valuable translational insights for human therapeutic development. The balanced approach of testing against both species' receptors early in the development process is particularly important given the documented differences in ligand binding and antagonist sensitivity .
Genetic engineering of CXCR2 expression offers powerful strategies to enhance cell-based therapeutic approaches for various diseases:
Enhanced immune cell trafficking to disease sites:
NK cells genetically modified to express CXCR2 show improved migration along chemokine gradients of recombinant CXCR2 ligands or tumor supernatants
This enhanced trafficking results in increased killing of target cells
While functionality remains unchanged compared to control NK cells, CXCR2-transduced NK cells develop increased adhesion properties and form more conjugates with target cells
Optimized expression systems:
Combined approaches for enhanced efficacy:
Co-expression of CXCR2 with cytokines or cytotoxic molecules
Engineering cells to express both CXCR2 and CAR (Chimeric Antigen Receptors) for improved tumor targeting
Dual-targeting approaches combining chemotaxis and specific antigen recognition
Addressing challenges in CXCR2 expression:
Primary NK cells rapidly lose CXCR2 expression upon in vitro culture and expansion
Genetic modification effectively restores this expression
Similar approaches can address the observation that tumor-infiltrating NK cells from renal cell carcinoma patients express lower CXCR2 compared with peripheral blood NK cells
Therapeutic applications:
Adoptive cell therapy for cancer using CXCR2-modified immune cells
Treatment of inflammatory conditions through targeted delivery of anti-inflammatory cells
Regenerative medicine applications targeting CXCR2-expressing tissues
This approach represents a novel strategy to improve anti-tumor responses following adoptive transfer of immune cells. By enhancing the migration capability of therapeutic cells, genetic engineering of CXCR2 expression addresses a major limitation of current cell-based therapies: poor trafficking to disease sites. The studies demonstrating this concept provide strong evidence that receptor re-expression through genetic engineering is a viable approach to enhance therapeutic efficacy .