Recombinant Macaca mulatta C-X-C chemokine receptor type 2 (CXCR2)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Sequence

Recombinant Macaca mulatta CXCR2 retains the canonical seven-transmembrane (7TM) topology of GPCRs, with distinct extracellular and intracellular domains. The full-length protein (UniProt ID: Q28519) spans 420 amino acids and includes:

DomainAmino Acid Sequence (Partial)Functional Role
N-terminalFNMESDSFEDLWKGEDFSNYSYSSDLPPSLPDVAPCRPESLEINKYFLigand recognition and binding
Transmembrane 1VVIIYALVFLLSLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFAnchoring to cell membrane
Extracellular Loop 2RRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLigand specificity and signal transduction
C-terminalLISKDSLPKDSRPSFVGSSSGHTReceptor internalization and recycling

The recombinant variant expressed in E. coli or mammalian systems typically includes residues 1–353 to enhance solubility while preserving functional epitopes .

Ligand Binding and Signaling Mechanisms

CXCR2 binds ELR+ CXC chemokines (e.g., CXCL1, CXCL8/IL-8) through its extracellular N-terminal domain and transmembrane helices. Key findings include:

  • Affinity Differences: Macaque CXCR2 binds human IL-8 with higher affinity (Kd = 46 pM) compared to human CXCR2 (Kd = 220 pM), but shows reduced affinity for CXCL1 (Kd = 3.7 nM vs. 540 pM in humans) .

  • Antagonist Sensitivity: The CXCR2-specific antagonist SB225002 exhibits 10-fold lower potency in macaque receptors, suggesting species-specific conformational variations .

  • Downstream Pathways: Activation triggers Gαi-mediated MAPK, PI3K/AKT, and β-arrestin signaling, driving neutrophil chemotaxis and tumor microenvironment remodeling .

Inflammatory Responses

  • Neutrophil Recruitment: CXCR2 orchestrates neutrophil migration via IL-8 and CXCL1 gradients, with macaque models showing conserved mechanisms for studying human inflammatory diseases .

  • Receptor Trafficking: Phosphorylation of serine residues in the C-terminus regulates clathrin-mediated internalization, with Rab5 GTPases directing lysosomal degradation or plasma membrane recycling .

Cancer Biology

  • Gastric Cancer (GC): CXCR2/STAT3 feed-forward loops in GC cells amplify metastasis by interacting with tumor-associated macrophages (TAMs) secreting CXCL1/CXCL5. Knockdown of CXCR2 reduces lymph node metastasis by 50% in xenograft models .

  • Therapeutic Targeting: Small-molecule antagonists (e.g., AZD5069) suppress GC growth by disrupting CXCR2-mediated EMT and stromal crosstalk .

Applications in Biomedical Research

ApplicationExperimental UseReference
Drug DevelopmentHigh-throughput screening for CXCR2 antagonists in inflammatory and oncology trials
Structural BiologyCryo-EM studies to resolve ligand-binding conformations
Primate Disease ModelingInvestigating neutrophil dysregulation in COPD and atherosclerosis

Challenges and Future Directions

  • Species-Specific Variability: Differences in ligand affinity between human and macaque CXCR2 necessitate careful interpretation of preclinical data .

  • Biased Signaling: Developing ligands that selectively activate anti-inflammatory pathways (e.g., β-arrestin) without inducing neutropenia remains a priority .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific requests for the format. Please indicate your preferred format in the order notes, and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All protein shipments are standardly packed with blue ice packs. Should you require dry ice packaging, please communicate with us in advance for an additional fee.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and inherent protein stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it accordingly.
Synonyms
CXCR2; IL8RB; C-X-C chemokine receptor type 2; CXC-R2; CXCR-2; High affinity interleukin-8 receptor B; IL-8R B; CD antigen CD182; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Macaca mulatta (Rhesus macaque)
Target Names
Target Protein Sequence
FNMESDSFEDLWKGEDFSNYSYSSDLPPSLPDVAPCRPESLEINKYFVVIIYALVFLLSL LGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVS LLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPVLLF RRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFKAHM GQKHRAMRVIFAVVLIFLLCWLPYSLVLLADTLMRTQVIQETCERRNHIDRALDATEILG ILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHT
Uniprot No.

Target Background

Function
CXCR2 serves as the receptor for interleukin-8 (IL-8), a potent neutrophil chemotactic factor. Binding of IL-8 to CXCR2 activates neutrophils, triggering a response mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. CXCR2 exhibits high affinity binding to IL-8. It also binds with high affinity to CXCL3, GRO/MGSA, and NAP-2.
Database Links

UniGene: Mmu.26899

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Macaca mulatta CXCR2 and what are its key molecular characteristics?

Macaca mulatta CXCR2 (C-X-C motif chemokine receptor 2) is a protein-coding gene (Entrez Gene ID: 700407) found in rhesus monkeys, also known by synonyms CXC-R2, CXCR-2, and IL8RB. It encodes a G-protein-coupled receptor that functions as a receptor for chemokines, particularly interleukin-8 (IL-8) and growth-regulated oncogene alpha (Gro-alpha) . CXCR2 plays a crucial role in neutrophil chemotaxis following inflammatory stimuli and is highly expressed in blood cells.

Several transcript variants have been identified for this gene, including:

mRNAProteinName
XM_015111045.2XP_014966531.1C-X-C chemokine receptor type 2
XM_015111045.1XP_014966531.1C-X-C chemokine receptor type 2
XM_028831101.1XP_028686934.1C-X-C chemokine receptor type 2

The cloned ORF sequence is typically 1068bp in length, encoding a protein with the characteristic seven-transmembrane domain structure typical of chemokine receptors . This receptor is involved in inflammatory responses and has been implicated in various pathological conditions including inflammatory diseases and cancer progression .

How does Macaca mulatta CXCR2 compare to human CXCR2?

Key comparative binding affinities:

LigandMonkey CXCR2 Binding AffinityHuman CXCR2 Binding Affinity
IL-846 ± 28 pM220 ± 14 pM
Gro-α3.7 ± 2.2 nM540 ± 140 pM

This data indicates that monkey CXCR2 has a higher affinity for IL-8 but a significantly lower affinity for Gro-alpha compared to human CXCR2 . Additionally, pharmacological responses differ; the CXCR2-specific antagonist SB225002 is 10-fold more potent in inhibiting IL-8 binding to human CXCR2 than to monkey CXCR2, suggesting that amino acid sequence differences affect ligand binding sites or receptor conformation .

Despite these differences, both receptors are functionally active in inducing GTPγS exchange on membranes in response to IL-8 and Gro-alpha and in mediating chemotactic activity, confirming their functional homology .

What are the established protocols for cloning and expressing recombinant Macaca mulatta CXCR2?

Successful cloning and expression of recombinant Macaca mulatta CXCR2 typically involves the following methodological steps:

  • mRNA isolation: Extract total RNA from Macaca mulatta blood samples, which express high levels of CXCR2 .

  • cDNA synthesis: Perform reverse transcription using oligo(dT) primers or random hexamers.

  • PCR amplification: Design specific primers based on the known Macaca mulatta CXCR2 sequence to amplify the complete coding region.

  • Cloning into expression vector: Ligate the PCR product into an appropriate mammalian expression vector (e.g., pcDNA3.1-C-(k)DYK) . The ligation reaction typically includes:

    • PCR product (purified)

    • Linearized vector

    • T4 DNA ligase

    • Ligation buffer

    • Incubation at 16°C for 10 hours

  • Transformation: Transform the ligation mixture into competent E. coli cells (e.g., JM109) using heat shock (42°C for 90 seconds) .

  • Selection and verification: Select ampicillin-resistant colonies, extract plasmid DNA, and verify the insert by sequencing to ensure the correct CXCR2 sequence is present .

  • Large-scale plasmid preparation: Culture positive clones and extract plasmid DNA using commercial kits (e.g., QIAGEN plasmid plus Giga kit) for transfection experiments .

  • Expression in mammalian cells: Transfect the verified plasmid into appropriate mammalian cell lines (e.g., BaF3 cells) for functional studies .

Verification of successful expression can be accomplished using Western blotting, flow cytometry, or functional assays such as ligand binding or chemotaxis assays.

What experimental systems are recommended for studying Macaca mulatta CXCR2 function in vitro?

Several experimental systems have proven effective for studying Macaca mulatta CXCR2 function:

  • Recombinant expression systems: Transfected BaF3 cells have been successfully used to express CXCR2 and study its binding properties and signal transduction . These cells provide a clean background for receptor studies as they don't express endogenous chemokine receptors.

  • Primary neutrophils: Isolated from Macaca mulatta blood, these cells express endogenous CXCR2 and represent a physiologically relevant system for studying natural receptor function.

  • Reporter cell lines: Cells expressing CXCR2 fused to EGFP (Enhanced Green Fluorescent Protein) allow visualization of receptor localization and trafficking .

Key functional assays include:

  • Binding assays: Using radiolabeled or fluorescently labeled chemokines to measure receptor-ligand interactions and binding affinities .

  • GTPγS binding assays: To measure G-protein activation upon receptor stimulation .

  • Chemotaxis assays: Using Transwell chambers or microfluidic devices to quantify cell migration in response to chemokine gradients .

  • Calcium mobilization assays: To measure intracellular calcium flux upon receptor activation.

  • Conjugate formation assays: To assess adhesion properties of cells expressing CXCR2 .

When selecting an experimental system, consider the specific research question and whether native post-translational modifications are critical for your study.

How can CXCR2-targeted siRNA be effectively delivered in experimental models?

Effective delivery of CXCR2-targeted siRNA requires careful consideration of the delivery vehicle and modifications to enhance stability. A successful approach demonstrated in animal models includes:

  • siRNA design: Design siRNA sequences specifically targeting conserved regions of CXCR2 mRNA. Multiple siRNA sequences should be tested to identify those with highest knockdown efficiency .

  • Plasmid-based expression: Clone the siRNA sequence into expression vectors containing RNA polymerase III promoters (e.g., U6 promoter) to drive continuous expression of the siRNA .

  • Vector selection: The pDC316-EGFP-U6 plasmid has been successfully used, as it contains:

    • Human U6 promoter for siRNA expression

    • EGFP reporter gene for tracking transfected cells

    • SV40polyA signal for proper RNA processing

  • Chemical modifications: To improve in vivo stability, cholesterol modifications can be added to the plasmid using linking agents such as pyrrolidine. The resulting chol-pDC316-EGFP-U6-CXCR2-siRNA shows enhanced stability in the presence of nucleases in tissue and blood .

  • Delivery methods:

    • Liposomal transfection for in vitro studies

    • Liposome-encapsulated delivery for in vivo applications

    • Direct injection into target tissues

    • Hydrodynamic delivery for hepatic targeting

Successful knockdown can be verified by monitoring:

  • EGFP fluorescence to track plasmid expression (reported efficiency of approximately 10%)

  • Reduction in CXCR2 mRNA levels by RT-qPCR

  • Decreased CXCR2 protein levels by Western blot or flow cytometry

  • Functional assays such as reduced chemotaxis in response to CXCR2 ligands

This approach has demonstrated significant effects in animal models of disease, suggesting its potential utility in Macaca mulatta studies .

What is the role of CXCR2 in neutrophil trafficking and how can this be studied in Macaca mulatta models?

CXCR2 plays a central role in neutrophil trafficking by mediating chemotaxis in response to CXC chemokines, particularly IL-8 and Gro-alpha. In Macaca mulatta models, this process can be studied using several approaches:

  • Ex vivo neutrophil isolation and functional assessment:

    • Isolate neutrophils from Macaca mulatta blood using density gradient centrifugation

    • Evaluate CXCR2 expression by flow cytometry

    • Perform Transwell migration assays toward CXCR2 ligands (IL-8, Gro-alpha)

    • Measure calcium flux in response to ligand stimulation

    • Assess adhesion molecule expression (CD11b, CD18) after CXCR2 activation

  • Genetic modification approaches:

    • Transduce neutrophil precursors with lentiviral vectors expressing CXCR2 or CXCR2-targeting shRNA

    • Generate CXCR2-overexpressing cell lines to study enhanced migration

    • Use CXCR2-EGFP fusion proteins to track receptor localization during migration

  • In vivo models of inflammation:

    • Create localized inflammatory responses by injecting CXCR2 ligands

    • Use intravital microscopy to visualize neutrophil trafficking in real-time

    • Collect tissue samples to quantify neutrophil infiltration

    • Apply CXCR2 antagonists to confirm receptor-specific effects

  • Disease models:

    • Experimental autoimmune encephalomyelitis to study CXCR2-dependent inflammation

    • Infectious disease models (e.g., syphilis) where CXCR2 mediates immune cell recruitment

    • Cancer models to investigate CXCR2's role in tumor-associated neutrophil recruitment

Key techniques for quantifying neutrophil trafficking include flow cytometry of tissue digests, immunohistochemistry, myeloperoxidase assays, and advanced imaging techniques. These approaches have revealed that CXCR2 is essential for neutrophil extravasation from the bloodstream into inflamed tissues, and that targeting CXCR2 can reduce pathological neutrophil infiltration in various disease models .

How do species-specific differences in CXCR2 binding and signaling impact translational studies?

Species-specific differences in CXCR2 binding and signaling have significant implications for translational studies moving from Macaca mulatta models to human applications:

  • Ligand binding differences:

    • Monkey CXCR2 binds IL-8 with higher affinity (46 ± 28 pM) than human CXCR2 (220 ± 14 pM)

    • Conversely, monkey CXCR2 has substantially lower affinity for Gro-alpha (3.7 ± 2.2 nM) compared to human CXCR2 (540 ± 140 pM)

    • These differences suggest that the relative importance of different chemokines in vivo may vary between species

  • Antagonist potency variations:

    • The CXCR2 antagonist SB225002 is 10-fold more potent against human CXCR2 than monkey CXCR2

    • This necessitates dose adjustments when translating findings from animal studies to human applications

    • Drug candidates should be screened against both human and Macaca mulatta CXCR2 early in development

  • Structural implications:

    • Amino acid differences between human and monkey CXCR2 likely affect:

      • Ligand binding pockets

      • Receptor conformation

      • Interaction with intracellular signaling molecules

    • Molecular modeling can help identify key residues responsible for species differences

  • Translational considerations:

    • Efficacy in Macaca mulatta models may not directly predict human efficacy due to receptor differences

    • Pharmacokinetic/pharmacodynamic relationships established in monkeys require validation in human systems

    • Target engagement biomarkers should be established that work across species

What are the current approaches for using recombinant CXCR2 in therapeutic development for inflammatory diseases?

Recombinant CXCR2 from both human and Macaca mulatta sources plays a crucial role in therapeutic development for inflammatory diseases through several approaches:

  • High-throughput screening platforms:

    • Cell lines expressing recombinant CXCR2 enable screening of compound libraries

    • Parallel screening against human and Macaca mulatta CXCR2 identifies compounds with cross-species activity

    • Functional readouts include calcium flux, β-arrestin recruitment, and GTPγS binding

  • Antibody development:

    • Recombinant CXCR2 serves as an antigen for generating high-affinity antibodies

    • Picomolar antibodies targeting CXCR2 have shown promise in blocking neutrophil migration

    • These antibodies compete with natural ligands rather than targeting the ligands themselves, offering a distinct therapeutic approach compared to anti-TNF antibodies

  • Structure-based drug design:

    • Structural studies of recombinant CXCR2 guide rational design of antagonists

    • Comparative analysis of human and Macaca mulatta CXCR2 helps identify conserved binding pockets

    • In silico screening against receptor models accelerates lead identification

  • Preclinical validation:

    • Recombinant CXCR2-expressing systems validate target engagement

    • Macaca mulatta models provide translational insights for:

      • Inflammatory bowel disease

      • Chronic obstructive pulmonary disease

      • Rheumatoid arthritis

      • Cancer-associated inflammation

  • Genetic engineering approaches:

    • siRNA delivery methods targeting CXCR2 have shown efficacy in animal models

    • Cholesterol-modified plasmids containing CXCR2-siRNA demonstrate improved stability and delivery

    • These approaches have successfully reduced symptoms in conditions where inappropriate neutrophil migration contributes to pathology

The development of CXCR2 antagonists has significant therapeutic potential across multiple diseases, including inflammatory conditions and certain cancers where CXCR2 signaling promotes tumor growth and metastasis . Successful development requires accounting for the species-specific differences discussed previously to ensure that efficacy observed in Macaca mulatta models translates effectively to human patients.

What are the key considerations for developing specific antagonists for Macaca mulatta CXCR2?

Developing specific antagonists for Macaca mulatta CXCR2 requires careful consideration of several factors to ensure efficacy in both experimental models and potential therapeutic applications:

  • Structural and pharmacological differences:

    • The 10-fold difference in potency of SB225002 between human and monkey CXCR2 highlights the importance of species-specific testing

    • Comparative homology modeling of human and Macaca mulatta CXCR2 can identify key structural differences in the binding pocket

    • Compound libraries should be screened against both receptors to identify molecules with balanced activity

  • Binding mode characterization:

    • Determine whether compounds bind competitively with IL-8, Gro-alpha, or both

    • Evaluate allosteric modulators that may have different effects on various ligand interactions

    • Consider the potential for biased antagonism affecting specific signaling pathways

  • Pharmacokinetic considerations:

    • Optimize compounds for appropriate half-life in Macaca mulatta

    • Consider blood-brain barrier penetration if targeting neuroinflammatory conditions

    • Evaluate routes of administration suitable for long-term studies

  • Selectivity profiling:

    • Test against related chemokine receptors (especially CXCR1) to ensure specificity

    • Evaluate potential off-target effects on other GPCRs

    • Assess effects on other species' CXCR2 receptors if comparative studies are planned

  • Functional validation:

    • Confirm that binding translates to functional antagonism in cellular assays

    • Evaluate effects on multiple downstream pathways:

      • G-protein activation

      • β-arrestin recruitment

      • ERK phosphorylation

      • Chemotaxis inhibition

  • In vivo validation approaches:

    • Establish PK/PD relationships in Macaca mulatta

    • Develop target engagement biomarkers (e.g., ex vivo chemotaxis assays with blood neutrophils)

    • Test in relevant disease models where CXCR2 plays a key role

By addressing these considerations, researchers can develop antagonists that effectively target Macaca mulatta CXCR2 for research applications while also providing valuable translational insights for human therapeutic development. The balanced approach of testing against both species' receptors early in the development process is particularly important given the documented differences in ligand binding and antagonist sensitivity .

How can genetic engineering of CXCR2 expression enhance cell-based therapeutic approaches?

Genetic engineering of CXCR2 expression offers powerful strategies to enhance cell-based therapeutic approaches for various diseases:

  • Enhanced immune cell trafficking to disease sites:

    • NK cells genetically modified to express CXCR2 show improved migration along chemokine gradients of recombinant CXCR2 ligands or tumor supernatants

    • This enhanced trafficking results in increased killing of target cells

    • While functionality remains unchanged compared to control NK cells, CXCR2-transduced NK cells develop increased adhesion properties and form more conjugates with target cells

  • Optimized expression systems:

    • Lentiviral vectors provide stable, long-term expression of CXCR2 in primary immune cells

    • CXCR2-EGFP fusion proteins allow tracking of modified cells in vivo

    • Inducible expression systems enable temporal control of CXCR2 expression

  • Combined approaches for enhanced efficacy:

    • Co-expression of CXCR2 with cytokines or cytotoxic molecules

    • Engineering cells to express both CXCR2 and CAR (Chimeric Antigen Receptors) for improved tumor targeting

    • Dual-targeting approaches combining chemotaxis and specific antigen recognition

  • Addressing challenges in CXCR2 expression:

    • Primary NK cells rapidly lose CXCR2 expression upon in vitro culture and expansion

    • Genetic modification effectively restores this expression

    • Similar approaches can address the observation that tumor-infiltrating NK cells from renal cell carcinoma patients express lower CXCR2 compared with peripheral blood NK cells

  • Therapeutic applications:

    • Adoptive cell therapy for cancer using CXCR2-modified immune cells

    • Treatment of inflammatory conditions through targeted delivery of anti-inflammatory cells

    • Regenerative medicine applications targeting CXCR2-expressing tissues

This approach represents a novel strategy to improve anti-tumor responses following adoptive transfer of immune cells. By enhancing the migration capability of therapeutic cells, genetic engineering of CXCR2 expression addresses a major limitation of current cell-based therapies: poor trafficking to disease sites. The studies demonstrating this concept provide strong evidence that receptor re-expression through genetic engineering is a viable approach to enhance therapeutic efficacy .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.