Recombinant Macaca mulatta Cannabinoid receptor 1 (CNR1)

Shipped with Ice Packs
In Stock

Description

Recombinant Production Systems

Multiple expression platforms have been validated for CNR1 production:

Expression SystemAdvantagesProduct Code Examples
Mammalian CellsProper post-translational modificationsCSB-MP758268MOW1, CNR1-947R
E. coliCost-effective for structural studiesCSB-CF758268MOW
BaculovirusHigh yield for functional assaysCSB-BP758268MOW1
YeastScalable productionCSB-YP758268MOW1

Key quality parameters:

  • Purity: >80% by SDS-PAGE

  • Endotoxin: <1.0 EU/μg (LAL method)

  • Tagging: His-tag for purification convenience

Biochemical Validation Data

Functional characterization from ELISA binding assays demonstrates:

  • EC₅₀: 41.72-63.54 ng/mL for antibody-receptor interaction

  • Storage Stability:

    • Short-term: +4°C in PBS buffer

    • Long-term: -80°C with lyophilization option

Neuroscience Research Applications

Recent studies in primate models reveal:

  • Neural Circuit Modulation:

    • Dense CB1R+ axon terminals in basolateral nuclear complex (BNC) regulate GABAergic transmission

    • 83% of perisomatic synapses on pyramidal neurons show CB1R immunoreactivity

  • Behavioral Correlates:

    • Mediates fear extinction through CCK+ basket cell modulation

    • Pharmacological activation reduces glutamate release by 40-60% in BNC slices

Comparative Species Reactivity

Antibody validation across species:

SpeciesCross-ReactivityApplications Supported
HumanStrongWB, ELISA, IHC
MouseModerateWB, IF
RatModerateELISA
RhesusNativeFunctional assays

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development according to your specification.
Synonyms
CNR1; Cannabinoid receptor 1; CB-R; CB1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-472
Protein Length
full length protein
Species
Macaca mulatta (Rhesus macaque)
Target Names
Target Protein Sequence
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE KMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIA VLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVF HRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLM WTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWK AHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLL AIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQ PLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Uniprot No.

Target Background

Function
The Cannabinoid receptor 1 (CNR1) is a G-protein coupled receptor for cannabinoids, including endocannabinoids (eCBs), such as N-arachidonoylethanolamide (also called anandamide or AEA) and 2-arachidonoylglycerol (2-AG). It mediates various cannabinoid-induced effects, including alterations in food intake, memory, gastrointestinal motility, catalepsy, ambulatory activity, anxiety, and chronic pain. Signaling typically involves a decrease in cyclic AMP levels. In the hypothalamus, CNR1 may exhibit a dual effect on mitochondrial respiration depending on the agonist dose and potentially the cell type. It increases respiration at low doses but decreases respiration at high doses. At high doses, CNR1 signal transduction involves G-protein alpha-i protein activation, subsequent inhibition of mitochondrial soluble adenylate cyclase, reduced cyclic AMP concentration, and inhibition of protein kinase A (PKA)-dependent phosphorylation of specific subunits of the mitochondrial electron transport system, including NDUFS2. In the hypothalamus, CNR1 inhibits leptin-induced reactive oxygen species (ROS) formation and mediates cannabinoid-induced increases in SREBF1 and FASN gene expression. In response to cannabinoids, CNR1 drives the release of orexigenic beta-endorphin, but not melanocyte-stimulating hormone alpha/alpha-MSH, from hypothalamic POMC neurons, thereby promoting food intake. In the hippocampus, CNR1 regulates cellular respiration and energy production in response to cannabinoids. It is involved in cannabinoid-dependent depolarization-induced suppression of inhibition (DSI), a process in which depolarization of CA1 postsynaptic pyramidal neurons mobilizes eCBs, which retrogradely activate presynaptic CB1 receptors, transiently decreasing GABAergic inhibitory neurotransmission. CNR1 also reduces excitatory synaptic transmission. In superior cervical ganglions and cerebral vascular smooth muscle cells, CNR1 inhibits voltage-gated Ca(2+) channels both constitutively and in an agonist-dependent manner. It induces leptin production in adipocytes and reduces LRP2-mediated leptin clearance in the kidney, contributing to hyperleptinemia. In adipose tissue, CNR1 signaling leads to increased expression of SREBF1, ACACA, and FASN genes. In the liver, activation by cannabinoids results in increased de novo lipogenesis and reduced fatty acid catabolism, associated with increased expression of SREBF1/SREBP-1, GCK, ACACA, ACACB, and FASN genes. CNR1 may also affect de novo cholesterol synthesis and HDL-cholesteryl ether uptake. Peripherally, CNR1 modulates energy metabolism. In high carbohydrate diet-induced obesity, CNR1 may decrease the expression of mitochondrial dihydrolipoyl dehydrogenase/DLD in striated muscles, as well as selected glucose/ pyruvate metabolic enzymes, thereby impacting energy expenditure through mitochondrial metabolism. In response to the cannabinoid anandamide, CNR1 elicits a proinflammatory response in macrophages, involving NLRP3 inflammasome activation and IL1B and IL18 secretion.
Gene References Into Functions
  1. This study provides unique evidence that the CB1R is dynamically and progressively involved from the start of mesial temporal lobe epileptogenesis PMID: 29663353
  2. The findings of this study provide a potential substrate for discrete, age-dependent effects of cannabinoid 1 receptor expression on the maturation of primate DLPFC circuitry. PMID: 19703937
Database Links

KEGG: mcc:574142

UniGene: Mmu.3522

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Mitochondrion outer membrane. Cell projection, axon. Cell junction, synapse, presynapse.

Q&A

What is the amino acid sequence of Macaca mulatta CNR1, and how does it compare to human CNR1?

Macaca mulatta CNR1 shares high sequence homology with human CNR1, typically around 96-98% identity at the amino acid level. This conservation is consistent with findings across other cannabinoid receptors in vertebrates, where nucleotide identity ranges from 62.6% to 81.9% and amino acid identity from 61.9% to 88.1% . The high sequence homology makes Macaca mulatta an excellent model for studying cannabinoid receptor pharmacology relevant to human applications.

The receptor features the characteristic seven-transmembrane structure typical of G-protein coupled receptors, with highly conserved domains critical for ligand binding and signal transduction. Like its human counterpart, it functions as a receptor for endogenous cannabinoids including anandamide (AEA) and 2-arachidonoylglycerol (2-AG), as well as phytocannabinoids such as THC .

What are the most reliable expression systems for producing recombinant Macaca mulatta CNR1?

Based on comparative studies, wheat germ cell-free expression systems have proven highly effective for producing functional recombinant cannabinoid receptors . This system is particularly valuable when membrane protein purity and native conformation are critical for downstream applications.

Alternative expression systems include:

  • Mammalian cell lines (HEK293, CHO)

  • Baculovirus-infected insect cells

  • Yeast expression systems

Each system offers different advantages depending on research goals. Mammalian cells provide appropriate post-translational modifications, while insect cells offer higher yields of properly folded receptor. Careful consideration of glycosylation patterns and binding properties is essential when selecting an expression system for CNR1 from non-human primates.

How is CNR1 distribution in Macaca mulatta brain different from that in rodent models?

CNR1 distribution in Macaca mulatta brain shows important similarities and differences compared to rodent models. In juvenile Macaca mulatta, CNR1 is highly expressed in the caudate nucleus (CAU) and putamen (PUT), consistent with its involvement in movement regulation .

This cross-species variation highlights the importance of using non-human primate models when investigating CNR1 in the context of neuropsychiatric disorders and potential therapeutics.

What are the optimal binding assay conditions for characterizing recombinant Macaca mulatta CNR1?

Optimal binding assay conditions for Macaca mulatta CNR1 characterization should be established using radioligand binding techniques similar to those used for human CNR1. Based on comparative studies with human and other species, the following approach is recommended:

  • Radioligand selection: [³H]MePPEP has demonstrated excellent properties as a high-affinity, selective antagonist radioligand for cannabinoid CB1 receptors across species . It shows saturable, reversible, and single-site high-affinity binding.

  • Buffer composition: 50 mM Tris-HCl (pH 7.4), 5 mM MgCl₂, 2.5 mM EDTA, and 0.5% BSA.

  • Incubation conditions: 30°C for 90 minutes to reach equilibrium.

  • Membrane preparation: 10-50 μg protein per assay tube.

  • Non-specific binding determination: Use rimonabant (1 μM) or similar selective CB1 antagonist.

Based on cross-species comparisons, expected Kd values for [³H]MePPEP binding to Macaca mulatta CNR1 should be approximately 0.15-0.20 nM, similar to the values reported for human (0.14 nM) and non-human primate (0.19 nM) CB1 receptors .

What techniques are most effective for distinguishing CNR1 from CNR2 expression in Macaca mulatta tissue samples?

Distinguishing CNR1 from CNR2 in Macaca mulatta tissue samples requires specific approaches due to potential cross-reactivity issues. The following techniques have proven most reliable:

  • Selective antibodies: Use antibodies raised against species-specific N-terminal epitopes, as this region shows greater divergence between CNR1 and CNR2.

  • RT-qPCR with specific primers: Design primers targeting unique regions, particularly the 3' untranslated region, which shows less conservation between receptor subtypes.

  • Autoradiography with selective ligands: [³H]MePPEP shows excellent selectivity for CNR1 over CNR2, with no specific binding observed in CNR1 knockout mouse tissue .

  • Pharmacological discrimination: Use selective antagonists (rimonabant for CNR1; SR144528 for CNR2) to differentiate receptor subtypes in functional assays.

When analyzing CNR1 expression in regions like the striatum where complex expression patterns exist, combining immunohistochemistry with in situ hybridization provides the most comprehensive approach to distinguish cellular and subcellular localization patterns .

How can researchers effectively compare functional responses between recombinant and native Macaca mulatta CNR1?

To effectively compare functional responses between recombinant and native Macaca mulatta CNR1, a multi-faceted approach is recommended:

  • G-protein activation assays: [³⁵S]GTPγS binding assays measure G-protein coupling efficiency in both recombinant systems and native tissue preparations.

  • Calcium mobilization assays: When CNR1 is expressed in systems with appropriate G-protein coupling, monitoring intracellular calcium can reveal functional differences.

  • cAMP inhibition measurement: Since CNR1 typically signals through inhibition of adenylyl cyclase, measuring cAMP reduction following agonist exposure provides a key functional readout .

  • Electrophysiological recordings: Particularly valuable in brain slice preparations containing native receptors.

  • Receptor internalization assays: Compare trafficking dynamics using fluorescently-tagged receptors.

For reliable comparisons, it's essential to use the same agonists across preparations and to normalize responses to receptor expression levels. When designing these experiments, researchers should be aware that CNR1 signaling may involve reduction in cyclic AMP but can also have dual effects on other pathways such as mitochondrial respiration depending on agonist dose and cell type .

What are the unique considerations when studying CNR1 expression patterns in specific brain regions of Macaca mulatta?

When investigating CNR1 expression patterns in specific brain regions of Macaca mulatta, several unique considerations must be addressed:

  • Developmental stage effects: Studies in juvenile monkeys reveal distinct CNR1 expression patterns that may not directly parallel adult expression . Age-matched controls are critical for developmental studies.

  • Regional heterogeneity: The striatum of Macaca mulatta shows differential CNR1 expression between subregions, with highest abundance in the putamen and caudate nucleus compared to the nucleus accumbens . This heterogeneity requires precise microdissection techniques.

  • Co-expression with other receptors: CNR1 co-localizes with dopamine D1 or D2 receptors in striatal regions, enabling interaction at the G-protein level . This interaction requires specialized co-immunoprecipitation or proximity ligation assays for accurate characterization.

  • Specialized neuroanatomical arrangements: In the basolateral amygdala complex, CNR1-positive terminals form distinctive basket-like plexuses around projection neuron somata , requiring high-resolution microscopy techniques to properly visualize.

  • Comparative approach requirement: Direct comparison with human and rodent expression patterns is essential for translational relevance, as certain aspects of CNR1 expression are primate-specific.

These considerations highlight the importance of combining multiple techniques (immunohistochemistry, in situ hybridization, and quantitative PCR) to fully characterize CNR1 expression patterns in primate brain regions.

How do post-translational modifications of Macaca mulatta CNR1 differ from those observed in human CNR1?

Post-translational modifications (PTMs) of Macaca mulatta CNR1 show substantial similarity to human CNR1, but with subtle differences that may affect receptor function:

When studying these PTMs, researchers should employ mass spectrometry-based approaches with appropriate enrichment strategies for specific modifications. Comparative studies between recombinant and native receptors are essential to confirm the physiological relevance of identified PTMs.

What strategies can resolve discrepancies between genomic sequence and cDNA of Macaca mulatta CNR1?

Resolving discrepancies between genomic sequence and cDNA of Macaca mulatta CNR1 requires a systematic approach similar to that used in other species where such differences have been observed:

  • RNA editing analysis: Systematic sequencing of both genomic DNA and cDNA from the same tissue samples can identify potential RNA editing events. This approach revealed differences in multiple codons when comparing CNR1 cDNA and genomic DNA in Rana esculenta .

  • Alternative splicing investigation: Using PCR primers spanning potential splice junctions to identify novel splice variants that may exist in primates.

  • Single-nucleotide polymorphism (SNP) analysis: Distinguishing between true RNA editing events and genetic polymorphisms requires sequencing from multiple individuals.

  • RNA structure prediction: As observed in other species, nucleotide changes between mRNA and genomic sequences can significantly affect RNA folding structures , potentially influencing translation efficiency or stability.

  • Cross-species comparison: Examining whether nucleotide changes observed in Macaca mulatta parallel those documented in other species like human, rat, zebrafish, and pufferfish .

These discrepancies may have functional significance, as some nucleotide changes can affect the predicted amino acid sequence, as observed in pufferfish . Both bioinformatic and experimental approaches are necessary to fully characterize and understand the implications of these differences.

How do endocannabinoid signaling pathways involving CNR1 in the Macaca mulatta striatum contribute to movement regulation?

Endocannabinoid signaling through CNR1 in the Macaca mulatta striatum appears to play a crucial role in movement regulation through several mechanisms:

  • Co-localization with dopamine receptors: CNR1 is co-localized with both D1 and D2 dopamine receptors in the striatum and can interact at the G-protein level, enabling complex modulation of motor circuits .

  • Regional distribution: CNR1 shows highest abundance in the putamen and caudate nucleus, striatal regions primarily associated with motor function, compared to the nucleus accumbens which is more involved in reward processing .

  • Retrograde synaptic signaling: CNR1 activation modulates both glutamatergic and dopaminergic signaling in striatal cells through retrograde endocannabinoid messengers.

  • Implications for movement disorders: The enriched expression of CNR1 in movement-associated striatal regions aligns with evidence for endocannabinoid system involvement in Parkinson's disease and haloperidol-induced catalepsy .

This specialized distribution and signaling arrangement suggests that CNR1 may serve as a fine-tuning mechanism for movement control in primates, potentially offering therapeutic targets for movement disorders that may be more translatable from Macaca models to humans than from rodent models.

What methodologies best characterize the interaction between CNR1 and cholecystokinin (CCK) systems in Macaca mulatta amygdala?

Characterizing the interaction between CNR1 and cholecystokinin (CCK) systems in the Macaca mulatta amygdala requires specialized methodologies that can capture their complex relationship:

  • Double immunohistochemical labeling: This technique has revealed that the monkey basolateral nuclear complex of the amygdala (BNC) contains high-density CB1R-positive axons, including terminals that form basket-like plexuses around projection neuron somata .

  • Electrophysiological recording with selective pharmacology: Combining whole-cell patch-clamp with selective agonists/antagonists for both systems can reveal functional interactions.

  • FRET/BRET proximity assays: These techniques can detect potential physical interactions between CCK and cannabinoid receptors or their downstream signaling components.

  • Ex vivo calcium imaging: This approach can visualize how CCK and CNR1 signaling converge to modulate neuronal activity patterns in amygdala circuits.

  • Behavioral paradigms with targeted pharmacology: Fear conditioning and anxiety tests combined with local infusion of selective agents can reveal the functional significance of these interactions.

These interactions appear particularly important for anxiety-like behavior and fear learning/expression , suggesting that the CCK-CNR1 interaction in the primate amygdala represents a specialized circuit with translational relevance to human anxiety disorders.

How can researchers effectively study the dual effects of CNR1 activation on mitochondrial respiration in Macaca mulatta hypothalamus?

Studying the dual effects of CNR1 activation on mitochondrial respiration in Macaca mulatta hypothalamus requires specialized approaches to capture dose-dependent and cell-type specific responses:

  • Ex vivo respirometry: Using freshly isolated hypothalamic tissue in a Seahorse XF analyzer to measure oxygen consumption rate (OCR) in response to graduated doses of CNR1 agonists.

  • Mitochondrial isolation: Purifying mitochondria from specific hypothalamic nuclei to directly assess CNR1 effects on isolated organelles.

  • Cell-type specific analyses: Employing laser-capture microdissection or fluorescence-activated cell sorting to isolate distinct hypothalamic cell populations before assessing respiration.

  • Combined electrophysiology and metabolism: Simultaneous recording of neuronal activity and real-time metabolic parameters to correlate bioenergetic changes with functional outcomes.

  • Mechanistic pathway analysis: Examining how different doses of CNR1 agonists differentially engage G-protein subtypes, particularly investigating the role of G-protein alpha-i in mediating high-dose inhibition of mitochondrial soluble adenylate cyclase .

This dual effect phenomenon, where CNR1 activation increases respiration at low doses but decreases it at high doses , represents a sophisticated signaling mechanism that may be critical for hypothalamic energy homeostasis regulation and could have implications for metabolic disorders.

What evolutionary insights can be gained from comparing CNR1 sequences across primates including Macaca mulatta?

Comparing CNR1 sequences across primates yields valuable evolutionary insights:

  • Functional domain conservation: The ligand-binding pocket and G-protein coupling domains show remarkable conservation across primates, reflecting the fundamental importance of cannabinoid signaling.

  • Species-specific variations: Targeted sequence differences in the N-terminal domain and intracellular loops may reflect adaptations to different dietary or environmental pressures across primate lineages.

  • Selection pressure analysis: Calculating dN/dS ratios (non-synonymous to synonymous substitution rates) across the CNR1 coding sequence reveals regions under positive or purifying selection.

  • Conservation relative to other vertebrates: While primate CNR1 sequences show high conservation among themselves, broader vertebrate comparisons reveal nucleotide identity ranging from 62.6% to 81.9% and amino acid identity from 61.9% to 88.1% .

  • RNA editing conservation: The phenomenon of differences between genomic and cDNA sequences observed in other vertebrates may represent an evolutionarily conserved regulatory mechanism worth investigating in Macaca mulatta.

These comparative analyses can reveal how cannabinoid signaling has been shaped by evolutionary pressures and identify primate-specific adaptations that may have relevance for understanding human-specific aspects of endocannabinoid function.

How do developmental changes in CNR1 expression in juvenile Macaca mulatta compare to those in humans?

Developmental changes in CNR1 expression in juvenile Macaca mulatta show important parallels and differences compared to human development:

  • Regional expression timing: Juvenile Macaca mulatta show enriched CNR1 expression in the caudate and putamen , following patterns that generally align with human CNR1 developmental trajectories.

  • Adolescent transitions: Both species exhibit significant changes in CNR1 density and distribution during adolescence, though the precise timing may differ relative to sexual maturation.

  • Implications for disease models: As noted in previous research, "juvenile monkeys were used in the present study, and thus, extrapolation to particular disease states which occur post-adolescence may be tenuous" . This highlights the importance of age-matching when modeling developmental disorders.

  • Receptor sensitivity changes: Developmental changes in G-protein coupling efficiency and desensitization mechanisms require careful characterization across age groups.

  • Sex differences: Sexual dimorphism in developmental CNR1 expression patterns may be present and should be systematically investigated.

Understanding these developmental trajectories is particularly important when using Macaca mulatta as a model for neurodevelopmental disorders or for studying the developmental effects of cannabinoid exposure.

What structural variations exist in the CNR1 gene between human and Macaca mulatta that might affect RNA processing?

Several structural variations in the CNR1 gene between human and Macaca mulatta may affect RNA processing:

  • Intron-exon boundaries: While the coding sequence is highly conserved, variations in splice site strength may lead to species-specific alternative splicing patterns.

  • Untranslated regions (UTRs): Differences in 5' and 3' UTR sequences can affect mRNA stability, localization, and translation efficiency.

  • RNA editing sites: As observed in comparisons between cDNA and genomic sequences in other species , specific adenosine-to-inosine editing sites may be conserved or divergent between humans and Macaca mulatta.

  • microRNA binding sites: Variations in 3' UTR sequences may alter the repertoire of microRNAs that can regulate CNR1 expression post-transcriptionally.

  • RNA secondary structure elements: Nucleotide changes, even synonymous ones, can significantly alter RNA folding structures , potentially affecting interaction with RNA-binding proteins involved in processing, export, and translation.

These variations may contribute to species-specific regulation of CNR1 expression and could explain some of the subtle differences in cannabinoid system function between humans and non-human primates that are not attributable to protein sequence differences alone.

What are the most effective strategies for overcoming antibody cross-reactivity issues when studying Macaca mulatta CNR1?

Overcoming antibody cross-reactivity issues when studying Macaca mulatta CNR1 requires several specialized approaches:

  • Epitope selection: Generate antibodies against highly species-specific regions, particularly the N-terminal domain or third intracellular loop, which show greater sequence divergence.

  • Pre-absorption controls: Validate antibody specificity by pre-absorbing with the immunizing peptide before immunohistochemistry or Western blotting.

  • Knockout controls: When possible, use tissue from CNR1 knockout animals (in other species) to confirm absence of signal, as demonstrated for [3H]MePPEP binding in mouse brain .

  • Multiple antibody validation: Use at least two antibodies raised against different epitopes to confirm staining patterns.

  • Complementary techniques: Combine antibody-based detection with mRNA localization via in situ hybridization to confirm expression patterns.

  • Recombinant protein standards: Include pure recombinant Macaca mulatta CNR1 protein as a positive control and related receptors (like CNR2) as specificity controls.

These approaches can significantly improve the reliability of immunodetection methods for studying CNR1 in non-human primate tissues.

How can researchers effectively control for individual variability in CNR1 expression when working with limited Macaca mulatta samples?

Controlling for individual variability in CNR1 expression with limited Macaca mulatta samples requires careful experimental design:

  • Paired tissue designs: When possible, use within-subject comparisons (e.g., treated vs. untreated hemisphere, or anatomically matched regions) to reduce inter-individual variation.

  • Comprehensive metadata collection: Record and analyze factors known to influence CNR1 expression, including age, sex, dominance status, stress exposure, and reproductive history.

  • Reference gene normalization: For quantitative analyses, use multiple stable reference genes validated specifically for Macaca mulatta tissues to normalize expression data.

  • Statistical approaches for small samples: Employ statistical methods designed for small sample sizes, such as non-parametric tests, bootstrapping, or Bayesian approaches.

  • Mixed-effects modeling: Account for individual as a random effect when analyzing data from multiple brain regions or time points from the same animals.

  • Power analyses: Conduct a priori power analyses using pilot data or published variability estimates to determine the minimum sample size needed for reliable detection of expected effect sizes.

These strategies can maximize the scientific value of limited primate samples while ensuring statistical robustness of the findings.

What specialized techniques are required for studying CNR1 trafficking and internalization in Macaca mulatta neurons?

Studying CNR1 trafficking and internalization in Macaca mulatta neurons requires specialized techniques adapted for primate neural tissue:

  • Live-cell imaging in acute brain slices: Utilizing fluorescently tagged ligands or antibodies against extracellular epitopes to track receptor movement in real-time.

  • Primary neuronal cultures: Establishing viable primary cultures from Macaca mulatta brain tissue with optimized protocols for transfection efficiency.

  • Biotinylation assays: Surface biotinylation followed by internalization periods to quantify receptor endocytosis rates.

  • Subcellular fractionation: Optimized protocols for separating membrane, endosomal, and lysosomal fractions from limited tissue samples.

  • Phospho-specific antibodies: To detect activation-dependent phosphorylation events that trigger internalization.

  • Electron microscopy with immunogold labeling: For high-resolution localization of CNR1 at synaptic and extrasynaptic sites before and after agonist exposure.

  • CRISPR-Cas9 genome editing: For introducing fluorescent tags at the endogenous CNR1 locus in induced pluripotent stem cells (iPSCs) derived from Macaca mulatta, which can then be differentiated into neurons.

These techniques must be adapted to account for the decreased viability of primate neurons in culture compared to rodent neurons and the limited availability of species-specific tools.

How should researchers interpret species differences in pharmacological profiles between human and Macaca mulatta CNR1?

When interpreting species differences in pharmacological profiles between human and Macaca mulatta CNR1, researchers should consider:

  • Binding affinity comparisons: Despite high sequence homology, subtle structural differences may affect ligand binding pockets. Compare Kd values systematically across species, as has been done with [3H]MePPEP, which showed Kd values of 0.14 nM for human and 0.19 nM for non-human primate CNR1 .

  • Signaling pathway divergence: Even with similar binding profiles, downstream signaling efficiency may differ due to species-specific interactions with G-proteins or scaffold proteins.

  • Allosteric modulation sensitivity: Test whether species differences are more pronounced for orthosteric versus allosteric ligands, which may recognize less conserved binding sites.

  • Tissue context influence: Compare pharmacological profiles in recombinant systems versus native tissue preparations to identify contextual factors that may amplify species differences.

  • Biased signaling analysis: Evaluate whether ligands show species-specific signaling bias (e.g., G-protein vs. β-arrestin pathways).

  • Extrapolation guidelines: Develop quantitative correction factors for translating Macaca mulatta data to human applications when systematic differences are identified.

These considerations are essential for appropriate translation of preclinical findings from Macaca models to human applications, particularly for drug development targeting the endocannabinoid system.

What statistical approaches best account for the complexity of CNR1 expression data across different brain regions?

Statistical approaches for analyzing CNR1 expression across brain regions must address the multidimensional nature of the data:

  • Mixed-effects models: These account for both within-subject (different brain regions from the same animal) and between-subject variability.

  • Multivariate pattern analysis: Techniques like principal component analysis (PCA) or factor analysis can identify coordinated expression patterns across regions, as demonstrated in studies of striatal subregions .

  • Spatial autocorrelation methods: These account for the non-independence of neighboring brain regions when mapping expression gradients.

  • Bayesian hierarchical modeling: Particularly useful for small sample sizes typical in primate research, allowing incorporation of prior knowledge.

  • Multiple comparison correction strategies: Region-specific analyses require appropriate correction methods; false discovery rate (FDR) approaches often provide better statistical power than family-wise error correction.

  • Longitudinal analysis techniques: For developmental studies tracking CNR1 expression changes over time.

  • Meta-analytic approaches: For integrating data across multiple studies with potentially different methodologies.

These approaches can help extract meaningful patterns from complex neuroanatomical expression data while appropriately controlling for statistical confounds.

How can researchers reconcile contradictory findings regarding CNR1 function in different experimental paradigms using Macaca mulatta?

Reconciling contradictory findings regarding CNR1 function across experimental paradigms requires systematic analysis of potential sources of variability:

  • Methodological harmonization analysis: Create a detailed table comparing key methodological parameters across studies (e.g., animal characteristics, tissue preparation, assay conditions) to identify critical variables.

  • Dose-response relationship characterization: Contradictions may reflect examination of different points on non-linear dose-response curves, particularly relevant given the dual effects of CNR1 activation on processes like mitochondrial respiration .

  • Context-dependent signaling analysis: Investigate whether contradictory findings reflect genuine biological variability in CNR1 function across contexts (e.g., stress conditions, circadian timing, neuronal activity state).

  • Individual difference factors: Systematically examine whether subject characteristics (age, sex, dominance status) correlate with divergent outcomes.

  • Integrative modeling approaches: Develop computational models that can account for apparently contradictory findings within a unified theoretical framework.

  • Rigorous replication studies: Design experiments specifically to test competing hypotheses under standardized conditions.

This systematic approach can transform apparently contradictory findings into deeper insights about the context-dependent nature of CNR1 signaling in primate systems.

What are the most promising therapeutic applications of CNR1 modulation based on Macaca mulatta studies?

Based on Macaca mulatta studies, several therapeutic applications of CNR1 modulation show particular promise:

  • Movement disorders: The enriched expression of CNR1 in the putamen and caudate nucleus of Macaca mulatta supports therapeutic potential for conditions like Parkinson's disease, where selective CNR1 modulation may help normalize striatal circuit function.

  • Anxiety and fear-related disorders: Studies revealing CNR1 expression in CCK-positive interneurons within the primate amygdala suggest targeted interventions for anxiety disorders, PTSD, and phobias.

  • Pain management: The involvement of CNR1 in chronic pain modulation in primate models provides a strong translational bridge to human applications.

  • Cognitive disorders: CNR1 modulation of memory processes in primates offers potential applications for age-related cognitive decline.

  • Metabolic regulation: The dual effects of CNR1 activation on mitochondrial respiration in the hypothalamus suggest nuanced approaches to metabolic disorders through targeted CNR1 modulation.

The high degree of conservation between Macaca mulatta and human CNR1 strengthens the translational potential of these approaches, particularly when interventions target primate-specific aspects of CNR1 expression or function not adequately modeled in rodents.

How do the effects of chronic cannabinoid exposure on CNR1 expression differ between Macaca mulatta and rodent models?

The effects of chronic cannabinoid exposure on CNR1 expression show important differences between Macaca mulatta and rodent models:

  • Region-specific adaptation: Primates show more nuanced region-specific adaptations, particularly in prefrontal cortical areas that are more developed than in rodents.

  • Temporal dynamics: CNR1 downregulation and desensitization following chronic exposure typically follow different time courses in primates compared to rodents.

  • Developmental sensitivity: Adolescent Macaca mulatta may show unique vulnerability patterns to chronic cannabinoid exposure compared to adult animals, with different critical windows than those identified in rodents.

  • Sex differences: Sexual dimorphism in adaptation to chronic exposure appears more pronounced in primates than rodents.

  • Cognitive correlates: Changes in CNR1 expression correlate with more complex cognitive outcomes in primates, including higher-order executive functions not easily assessed in rodent models.

These differences highlight the importance of non-human primate models for understanding long-term cannabinoid effects relevant to human conditions like cannabis use disorder, where rodent models may not fully capture the complexity of adaptation in higher cortical circuits.

What are the key challenges in developing CNR1-targeted therapeutics based on Macaca mulatta models?

Developing CNR1-targeted therapeutics based on Macaca mulatta models presents several key challenges:

Addressing these challenges requires integrated approaches combining in vitro human cell systems, computational modeling, and carefully designed primate studies focused on addressing specific translational questions that cannot be adequately addressed in other models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.