Recombinant Macaca mulatta Corticotropin-releasing factor receptor 1 (CRHR1)

Shipped with Ice Packs
In Stock

Description

Molecular and Genetic Characteristics

CRHR1 is a G protein-coupled receptor (GPCR) encoded by the CRHR1 gene (Entrez Gene ID: 574095). It binds corticotropin-releasing hormone (CRH), a key regulator of the hypothalamic-pituitary-adrenal (HPA) axis. Key features include:

PropertyDescription
Gene SymbolCRHR1
SynonymsCRF1, CRF-R1, CRFR-1
OrganismMacaca mulatta (Rhesus macaque)
Protein Length (Mature)392 amino acids (isoform X1) to 415 amino acids (full-length precursor)
Host Systems for ProductionE. coli, mammalian cells, yeast, baculovirus, cell-free expression
Purity≥85%–90% (SDS-PAGE verified)

Isoforms and Variants:
The CRHR1 gene produces multiple splice variants, including isoforms X1–X6, with distinct extracellular and transmembrane domains . For example:

  • Isoform X1: Lacks a portion of the N-terminal extracellular domain .

  • Full-Length Precursor: Includes a signal peptide critical for membrane localization .

Production and Purification

Recombinant CRHR1 is synthesized using heterologous expression systems, optimized for structural studies and ligand-binding assays:

Expression Systems

HostAdvantagesApplications
E. coliCost-effective, high yieldAntibody production, basic ligand studies
Mammalian Cells (HEK293)Proper post-translational modificationsFunctional assays, receptor signaling studies
Cell-Free ExpressionRapid production, soluble proteinStructural biology, crystallization

Tagging and Purification:

  • His-tagged variants facilitate affinity chromatography .

  • Purity: Validated via SDS-PAGE (>85% for most commercial preparations) .

Role in Stress and Ethanol Sensitivity

  • CRHR1 neurons in the lateral amygdala (LA) exhibit distinct inhibitory control and acute ethanol sensitivity compared to CRHR1-negative neurons. Ethanol enhances tonic inhibition in CRHR1+ cells, suggesting a neurobiological link to stress-alcohol interactions .

  • Genetic variants in CRHR1 are associated with neural circuit plasticity, influencing susceptibility to anxiety and depression in primates .

Evolutionary Conservation

  • The CRHR1 gene in Macaca mulatta shares >90% sequence homology with humans, making it a vital model for translational studies .

  • Rhesus macaques exhibit lower genome-wide recombination rates than humans, potentially stabilizing CRHR1 haplotypes linked to stress phenotypes .

Key Research Areas

  • Psychiatric Disorders: CRHR1 antagonists are explored for treating anxiety, depression, and addiction .

  • Stress Physiology: CRHR1 knockout models elucidate HPA axis dysregulation .

  • Drug Development: High-purity recombinant CRHR1 enables screening of small-molecule modulators .

Challenges and Future Directions

  • Structural Complexity: CRHR1’s seven-transmembrane domain complicates crystallization; cell-free systems may improve structural resolution .

  • Species-Specificity: While rhesus CRHR1 parallels human biology, differences in glycosylation patterns require careful interpretation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for precise delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this requirement in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
CRHR1; CRF1; Corticotropin-releasing factor receptor 1; CRF-R-1; CRF-R1; CRFR-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-415
Protein Length
Full Length of Mature Protein
Species
Macaca mulatta (Rhesus macaque)
Target Names
Target Protein Sequence
SLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNG YRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAFVLFLR LRSIRCLRNIIHWNLISAFILRNATWFVVQLTMSPEVHQSNVGWCRLVTAAYNYFHVTNF FWMFGEGCYLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWFGKR PGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLL GITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQD KHSIRARVARAMSIPTSPTRVSFHSIKQSTAV
Uniprot No.

Target Background

Function
Corticotropin-releasing factor receptor 1 (CRHR1) is a G-protein coupled receptor that binds to corticotropin-releasing factor (CRH) and urocortin (UCN). It exhibits high affinity for both CRH and UCN. Ligand binding induces a conformational change, triggering signaling via guanine nucleotide-binding proteins (G proteins) and downstream effectors, such as adenylate cyclase. CRHR1 promotes the activation of adenylate cyclase, leading to increased intracellular cAMP levels. It also inhibits the activity of the calcium channel CACNA1H. CRHR1 is essential for normal embryonic development of the adrenal gland and for proper hormonal responses to stress. It plays a role in the response to anxiogenic stimuli.
Gene References Into Functions
  1. This study suggests that variations in CRHR1 may influence brain function prior to any childhood adversity and may serve as a diathesis for the interaction between CRHR1 genotypes and childhood trauma, which has been reported to affect human psychopathology. PMID: 23147386
Database Links

KEGG: mcc:574095

UniGene: Mmu.3745

Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endosome.
Tissue Specificity
Expressed abundantly in the pituitary, cerebral cortex, hippocampus, amygdala and cerebellum.

Q&A

What is Macaca mulatta CRHR1 and what are its key structural characteristics?

Macaca mulatta CRHR1 (corticotropin releasing hormone receptor 1) is a protein-coding gene expressed in rhesus monkeys. It functions as a Class B1 G Protein-Coupled Receptor (GPCR) with distinctive structural features including:

  • A distal N-terminal extracellular domain (ECD) that specifically selects and binds ligands

  • A C-terminal tail that activates specific kinases to mediate signaling cascades

  • Multiple transmembrane domains characteristic of GPCRs

  • Several isoforms resulting from alternative splicing

The primary structure of CRHR1 in rhesus macaque contains specific domains that enable it to interact with corticotropin-releasing hormone (CRH) and activate downstream signaling events critical for stress response regulation . The receptor shares significant homology with human CRHR1, making it valuable for translational research applications.

What are the known isoforms of Macaca mulatta CRHR1 and how do they differ functionally?

Multiple isoforms of Macaca mulatta CRHR1 have been identified through genomic analysis. Based on available data, the following isoforms have been cataloged:

mRNA ReferenceProtein ReferenceIsoform Name
NM_001032803.1NP_001027975.1corticotropin-releasing factor receptor 1 precursor
XM_015119720.2XP_014975206.1corticotropin-releasing factor receptor 1 isoform X5
XM_028835444.1XP_028691277.1corticotropin-releasing factor receptor 1 isoform X3
XM_028835443.1XP_028691276.1corticotropin-releasing factor receptor 1 isoform X1
XM_015119719.2XP_014975205.1corticotropin-releasing factor receptor 1 isoform X2
XM_028835446.1XP_028691279.1corticotropin-releasing factor receptor 1 isoform X6
XM_015119720.1XP_014975206.1corticotropin-releasing factor receptor 1 isoform X2
XM_028835445.1XP_028691278.1corticotropin-releasing factor receptor 1 isoform X4

These isoforms differ in their sequence composition, potentially affecting ligand binding specificity, signaling efficiency, and subcellular localization. Researchers should consider these variations when designing experiments, as the functional differences between isoforms may influence experimental outcomes and interpretation of results .

What primary signaling pathways are activated by Macaca mulatta CRHR1 upon ligand binding?

Upon activation by CRH, Macaca mulatta CRHR1 engages multiple signaling cascades:

  • cAMP-dependent pathway: CRHR1 primarily couples to Gαs proteins, triggering adenylyl cyclase activation and subsequent cAMP accumulation. This leads to activation of the cAMP-MAPK (mitogen-activated protein kinase) pathway .

  • Calcium mobilization pathway: The receptor can also couple to Gαq proteins, resulting in phospholipase C activation and intracellular calcium release .

  • Downstream effector activation: These primary signaling events lead to activation of:

    • Protein kinase A (PKA)

    • cAMP-response element binding protein (CREB)

    • Protein kinase B (Akt)

    • Protein kinase C (PKC)

The specific pathway activated depends on the coupling with different G proteins, the bound ligand, and the cellular context. Experimental validation of these pathways in Macaca mulatta cells reveals dose-dependent responses to CRH stimulation, measurable through techniques like luciferase reporter assays, ELISA-based cAMP quantification, and calcium imaging .

How should researchers design experiments to characterize CRHR1 internalization dynamics following ligand binding?

To effectively characterize CRHR1 internalization dynamics, researchers should implement a multi-faceted approach:

  • Fusion protein construction: Generate CRHR1-EGFP (or other fluorescent protein) fusion constructs to visualize receptor trafficking. The tag should be positioned to minimize interference with receptor function .

  • Cell model selection: HEK293 cells provide a reliable heterologous expression system, though primary neuronal cultures may offer more physiologically relevant contexts.

  • Time-course experiments: Conduct internalization assays at multiple time points (0, 5, 15, 30, and 60 minutes) following ligand exposure to capture the complete internalization kinetics .

  • Visualization techniques:

    • Confocal microscopy using membrane markers (e.g., DiI) to distinguish membrane-bound from internalized receptors

    • Nuclear counterstaining with DAPI to establish cellular landmarks

    • Z-stack imaging to ensure comprehensive detection of internalized receptors

  • Quantification methods:

    • Measure changes in membrane fluorescence intensity over time

    • Quantify formation of endocytic vesicles

    • Apply colocalization analysis with markers of early endosomes, recycling endosomes, and lysosomes

Based on published research with other species' CRHR1, researchers should expect to observe significant internalization beginning around 5-15 minutes post-stimulation, with most receptors internalized by 30-60 minutes .

What methodological approaches should be used to accurately measure CRHR1-mediated cAMP production?

To rigorously assess CRHR1-mediated cAMP production, researchers should consider multiple complementary techniques:

  • CRE-luciferase reporter system:

    • Transiently co-transfect cells with CRHR1 expression vectors and CRE-luciferase constructs

    • Treat cells with varying concentrations of ligand (10-1000 nM range)

    • Measure luciferase activity as an indirect readout of cAMP-dependent CREB activation

  • Direct cAMP quantification by ELISA:

    • Use commercial cAMP detection kits

    • Optimize cell density and incubation times (typically 15 minutes for acute responses)

    • Include phosphodiesterase inhibitors to prevent cAMP degradation

    • Generate standard curves for accurate quantification

  • Real-time cAMP monitoring:

    • Employ FRET-based biosensors (e.g., EPAC-based sensors) for continuous, live-cell monitoring

    • This approach provides temporal resolution not available with endpoint assays

  • Controls and validation:

    • Include positive controls (forskolin) to validate assay functionality

    • Use concentration-response curves to determine EC50 values

    • Assess potential receptor desensitization with repeated stimulation

Published data demonstrates CRHR1-dependent cAMP accumulation occurs in a dose-dependent manner, with detectable responses at concentrations as low as 10 nM CRH and saturation typically occurring at 100-1000 nM .

What are the methodological challenges in studying calcium mobilization mediated by Macaca mulatta CRHR1?

Studying calcium mobilization mediated by CRHR1 presents several methodological challenges that researchers must address:

  • Selection of appropriate calcium indicators:

    • Ratiometric indicators (Fura-2/AM) provide more reliable quantification than single-wavelength indicators by correcting for uneven dye loading and photobleaching

    • Genetically encoded calcium indicators may be preferable for long-term studies

  • Temporal resolution considerations:

    • Calcium responses are typically rapid and transient

    • High-frequency imaging (>1 Hz) is necessary to capture peak responses

    • Continuous recording for at least 2-3 minutes post-stimulation is recommended

  • Signal specificity verification:

    • Distinguish CRHR1-specific calcium responses from non-specific fluctuations using:

      • Specific antagonists (e.g., antalarmin for CRHR1)

      • Control cells lacking CRHR1 expression

      • Calcium-free extracellular solutions to identify contribution of internal stores versus external calcium

  • Technical setup optimization:

    • Minimize mechanical disturbances during solution changes

    • Maintain stable temperature (ideally 37°C)

    • Account for potential photobleaching and phototoxicity

  • Data analysis approaches:

    • Determine baseline fluorescence before stimulation

    • Calculate F/F0 or ΔF/F0 for normalized comparisons

    • Quantify response amplitude, area under curve, and response kinetics

Published experimental protocols demonstrate successful calcium mobilization measurement using Fura-2/AM loading followed by stimulation with varying concentrations of CRH. Researchers should expect to observe rapid calcium transients that may show different kinetics compared to cAMP responses .

What are the most reliable approaches for detecting recombinant CRHR1 expression in heterologous systems?

For robust detection of recombinant CRHR1 expression, researchers should employ multiple complementary methods:

  • Fluorescent fusion proteins:

    • CRHR1-EGFP fusion constructs allow direct visualization

    • Confirm membrane localization using co-staining with plasma membrane markers (DiI)

    • Validate that fusion does not impair receptor function through signaling assays

  • Immunodetection methods:

    • Western blotting using antibodies against CRHR1 or epitope tags

    • Flow cytometry for quantitative assessment of surface expression

    • Immunocytochemistry for subcellular localization studies

  • Functional validation:

    • Ligand binding assays using radiolabeled or fluorescently labeled CRH

    • Downstream signaling assays (cAMP, calcium) to confirm functionality

    • Receptor internalization studies following ligand exposure

  • mRNA confirmation:

    • RT-PCR to verify transcription of the recombinant construct

    • qRT-PCR for quantitative assessment of expression levels

When using heterologous expression systems like HEK293 cells, researchers should optimize transfection conditions to achieve consistent expression levels across experiments. Confocal microscopy has successfully demonstrated membrane localization of CRHR1-EGFP fusion proteins, with clear colocalization with membrane markers like DiI .

What tissue distribution pattern does CRHR1 exhibit in Macaca mulatta, and how should researchers approach tissue-specific expression studies?

CRHR1 exhibits a specific tissue distribution pattern in Macaca mulatta that researchers should consider when designing expression studies:

  • Primary expression sites:

    • Brain regions: frontal cortical areas, forebrain, brainstem, amygdala, cerebellum

    • Endocrine tissues: anterior pituitary

    • Additional tissues: may include heart, liver, and reproductive organs

  • Methodological approach for tissue distribution studies:

    • Tissue collection and processing:

      • Rapidly collect and stabilize tissues to preserve RNA integrity

      • For brain regions, consider microdissection techniques for anatomical precision

      • Fix samples appropriately for protein vs. RNA analysis (4% PFA for histology)

    • RNA-based detection:

      • Extract high-quality total RNA using appropriate methods (TRIzol)

      • Verify RNA quality through electrophoresis and spectrophotometric analysis

      • Perform RT-PCR using CRHR1-specific primers

      • Consider qRT-PCR for comparative expression analysis across tissues

    • Protein-based detection:

      • Immunohistochemistry with validated anti-CRHR1 antibodies

      • Western blot analysis of tissue lysates

      • Consider laser-capture microdissection for region-specific analysis

  • Controls and validation:

    • Include known CRHR1-expressing tissues as positive controls

    • Verify primer specificity through sequencing of PCR products

    • Include antibody validation using recombinant CRHR1 expression systems

Studies in other species suggest CRHR1 expression varies across developmental stages and physiological conditions, highlighting the importance of standardizing sample collection protocols .

How does the genetic variation in CRHR1 impact mental health outcomes, and what methodological approaches best capture these associations?

Genetic variation in CRHR1 has been associated with mental health outcomes, particularly in the context of stress response and depression. Research approaches to investigate these associations include:

  • Key genetic variations:

    • SNPs including rs7209436, rs110402, and rs242924 form a protective TAT haplotype

    • This haplotype has been associated with protection against adult depressive symptoms in individuals who experienced childhood maltreatment

  • Study design considerations:

    • Longitudinal cohort studies provide stronger evidence than cross-sectional designs

      • Examples include the E-Risk Study (women followed to age 40, N=1116) and the Dunedin Study (men and women followed to age 32, N=1037)

      • These studies achieved 96% retention rates, minimizing selection bias

    • Outcome measures:

      • Clinical diagnoses of major depressive disorder using standardized criteria

      • Quality of life assessments using validated instruments (e.g., SF-36)

      • Consideration of both past-year and recurrent depression phenotypes

  • Environmental exposure assessment:

    • Childhood maltreatment measures (e.g., Childhood Trauma Questionnaire)

    • Prospective vs. retrospective assessment considerations

    • Multiple informant approaches to minimize recall bias

  • Statistical approaches:

    • Gene × environment interaction models

    • Haplotype analysis rather than single SNP approaches

    • Correction for multiple testing (e.g., Bonferroni)

    • Consideration of potential confounders

Research has shown that CRHR1 minor genotype carriers had higher quality of life scores in mental health (OR = 1.31-1.6, p < 0.05), role-emotional (OR = 1.57, p = 0.04), and vitality scales (OR = 1.31-1.38, p < 0.05) compared to those with the major genotype . These findings suggest that genetic variation in CRHR1 may influence stress reactivity and subsequent mental health outcomes.

What experimental approaches should researchers use to study the functional implications of different CRHR1 isoforms in neuronal systems?

To effectively investigate functional differences between CRHR1 isoforms in neuronal systems, researchers should implement the following experimental approaches:

  • Isoform-specific expression systems:

    • Generate constructs expressing individual CRHR1 isoforms (X1-X6)

    • Verify expression using isoform-specific antibodies or epitope tags

    • Consider inducible expression systems to control expression timing

  • Neuronal model systems:

    • Primary neuronal cultures from relevant brain regions

    • Neuronal differentiated iPSCs for human-relevant models

    • Organotypic brain slice cultures for preserved circuit architecture

    • In vivo viral-mediated expression in specific brain regions

  • Functional assays:

    • Electrophysiology:

      • Patch-clamp recordings to assess changes in neuronal excitability

      • Field potential recordings to examine network activity

    • Calcium imaging:

      • Single-cell calcium dynamics in response to CRH

      • Network-level calcium oscillations

    • Signaling pathway analysis:

      • Phospho-specific antibodies to key signaling proteins (CREB, ERK)

      • Quantitative proteomics to assess differential pathway activation

    • Neurite outgrowth and synaptogenesis:

      • Morphological analysis of dendrite complexity

      • Synaptic marker quantification

  • Behavioral correlates:

    • Conditional expression of specific isoforms in animal models

    • Assessment of stress responsivity and anxiety-related behaviors

    • Cognitive testing (learning, memory, executive function)

  • Comparative analysis framework:

    • Direct comparison of signaling kinetics between isoforms

    • Analysis of differential binding partners using proteomic approaches

    • Assessment of subcellular localization differences

These approaches would enable researchers to determine whether functional differences between CRHR1 isoforms contribute to region-specific or context-dependent effects of CRH signaling in the brain.

How can researchers effectively design experimental protocols to study CRHR1 pharmacology and identify potential therapeutic targets?

Designing robust experimental protocols for CRHR1 pharmacology requires systematic approaches to characterize ligand interactions and identify therapeutic targets:

  • Ligand binding characterization:

    • Radioligand binding assays:

      • Use [125I]-CRH or other radiolabeled ligands

      • Determine binding affinity (Kd) and receptor density (Bmax)

      • Conduct competition binding with potential therapeutic compounds

    • Surface plasmon resonance:

      • Real-time kinetic analysis of binding interactions

      • Determine association and dissociation rates

      • Evaluate temperature and pH dependencies

  • Functional response assays:

    • Signaling pathway activation:

      • cAMP accumulation assays using ELISA or CRE-luciferase reporters

      • Calcium mobilization using ratiometric indicators like Fura-2/AM

      • ERK phosphorylation via western blotting or ELISA

    • Receptor internalization:

      • Fluorescence microscopy of tagged receptors

      • Flow cytometry for quantitative assessment

      • Antibody feeding assays for endogenous receptors

  • Structure-activity relationship studies:

    • Systematic modification of CRH peptide sequence

    • Analysis of binding domain interactions

    • Virtual screening and molecular docking

  • Allosteric modulator identification:

    • Screens for compounds that modulate CRH efficacy

    • Assessment of signaling bias (preferential activation of specific pathways)

    • Evaluation of orthosteric vs. allosteric binding sites

  • Therapeutic relevance validation:

    • Ex vivo systems:

      • Brain slice preparations from regions expressing CRHR1

      • Primary neuronal cultures treated with stress hormones

    • In vivo models:

      • Behavioral assessments in stress and anxiety models

      • HPA axis function evaluation

      • PK/PD studies of lead compounds

When designing these studies, researchers should consider the complex interplay between CRHR1 and other stress-response systems, as well as potential differential effects of compounds on various CRHR1 isoforms present in different tissues.

What expression systems are most suitable for producing functional recombinant Macaca mulatta CRHR1, and what purification strategies yield highest receptor quality?

Selecting appropriate expression systems and purification strategies is critical for obtaining high-quality functional recombinant CRHR1:

  • Expression system selection:

    • Mammalian cell systems:

      • HEK293 cells provide proper post-translational modifications and folding

      • CHO cells offer stable integration and scalability

      • Both systems have demonstrated successful CRHR1 expression with functional validation

    • Insect cell systems:

      • Sf9 or High Five cells with baculovirus vectors

      • Higher protein yields than mammalian systems

      • May have differences in glycosylation patterns

    • Cell-free systems:

      • Limited utility for full-length GPCRs but useful for extracellular domains

      • Consider for production of the N-terminal ligand-binding domain

  • Expression optimization strategies:

    • Codon optimization for the expression host

    • Addition of signal sequences for improved membrane targeting

    • N-terminal tags (e.g., FLAG, His) for detection and purification

    • Fusion partners (e.g., EGFP) for expression monitoring and functional studies

  • Purification approaches:

    • Membrane preparation:

      • Mechanical disruption or nitrogen cavitation

      • Differential centrifugation to isolate membrane fractions

    • Solubilization:

      • Detergent screening (DDM, LMNG, GDN)

      • Lipid nanodiscs or SMALPs for native-like environment

    • Affinity purification:

      • Immobilized metal affinity chromatography for His-tagged constructs

      • Ligand-affinity chromatography using immobilized CRH

    • Size exclusion chromatography:

      • Final polishing step to ensure homogeneity

      • Assessment of receptor oligomeric state

  • Quality control assessments:

    • SDS-PAGE and western blotting for purity and identity

    • Ligand binding assays to confirm functionality

    • Mass spectrometry for protein integrity

    • Thermal stability assays to evaluate protein quality

These approaches have been successfully implemented for other GPCR family members and can be adapted specifically for Macaca mulatta CRHR1 production.

How do the structural and functional properties of Macaca mulatta CRHR1 compare to human CRHR1, and what are the implications for translational research?

Understanding the similarities and differences between Macaca mulatta and human CRHR1 is crucial for translational research applications:

  • Sequence and structural homology:

    • High sequence identity between human and macaque CRHR1 (typically >95%)

    • Conservation of key functional domains:

      • Ligand binding extracellular domain

      • G-protein coupling intracellular regions

      • Transmembrane domains

  • Pharmacological comparison:

    • Similar binding affinities for endogenous CRH

    • Comparable activation by urocortin peptides

    • Potential species differences in response to synthetic ligands and antagonists

  • Signaling pathway conservation:

    • Both primarily couple to Gαs, triggering cAMP production

    • Secondary coupling to Gαq and calcium mobilization

    • Similar activation of downstream kinases (PKA, MAPK, etc.)

  • Genetic variation:

    • Conservation of key polymorphic sites

    • The TAT haplotype (rs7209436, rs110402, rs242924) associated with stress resilience in humans has homologous counterparts in macaques

  • Implications for translational research:

    • Pre-clinical model validity:

      • Macaque models provide good predictive value for human CRHR1-targeted therapeutics

      • Consider potential species differences in drug metabolism and distribution

    • Neuroanatomical considerations:

      • Similar brain distribution patterns enhance translational relevance

      • Comparable HPA axis organization and function

    • Behavioral correlates:

      • Macaques display complex social behaviors and stress responses

      • Cognitive testing paradigms can closely parallel human assessments

  • Methodological recommendations:

    • Direct comparative studies of human and macaque CRHR1 in identical expression systems

    • Parallel pharmacological profiling with potential therapeutic compounds

    • Cross-species validation of genetic findings

The high conservation between species makes Macaca mulatta an excellent model for studying CRHR1 function relevant to human health and disease, particularly for stress-related disorders and HPA axis dysregulation.

What approaches should researchers use to study CRHR1 involvement in the pathophysiology of stress-related disorders?

Investigating CRHR1's role in stress-related disorders requires multi-level research approaches:

  • Genetic association studies:

    • Design considerations:

      • Case-control designs for psychiatric disorders

      • Longitudinal cohorts for developmental trajectories

      • Assessment of gene × environment interactions

    • Specific genetic variants:

      • Focus on functional SNPs (rs7209436, rs110402, rs242924)

      • Consider haplotype analysis rather than single SNPs

      • Evaluate epigenetic modifications in response to stress

  • Molecular and cellular mechanisms:

    • Receptor expression regulation:

      • Analysis of promoter activity and transcription factors

      • Investigation of stress-induced expression changes

      • Exploration of epigenetic modifications

    • Signaling pathway alterations:

      • Examination of desensitization and internalization dynamics

      • Investigation of pathway-specific adaptations to chronic stress

      • Identification of altered protein-protein interactions

  • Neural circuit approaches:

    • Optogenetic and chemogenetic techniques:

      • Cell-type specific manipulation of CRHR1-expressing neurons

      • Circuit-level analysis of stress response networks

    • In vivo calcium imaging:

      • Activity monitoring during stress exposure

      • Longitudinal assessment of circuit adaptations

  • Translational research models:

    • Animal models of stress disorders:

      • Chronic unpredictable stress

      • Social defeat stress

      • Early life stress paradigms

    • Pharmacological interventions:

      • CRHR1 antagonists (selective vs. non-selective)

      • Timing considerations (prevention vs. reversal)

      • Combination approaches with other targets

  • Clinical biomarker development:

    • Peripheral CRHR1-related markers:

      • HPA axis functional assessment

      • Stress hormone profiles

      • Genetic variants as potential stratification markers

Research has demonstrated that CRHR1 genetic variation is associated with differential mental health outcomes following stress exposure, with certain variants conferring protection against developing depression following childhood maltreatment . These findings underscore the importance of accounting for both genetic and environmental factors when studying CRHR1's role in stress-related pathophysiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.