Recombinant Macaca mulatta Duffy antigen/chemokine receptor (DARC)

Shipped with Ice Packs
In Stock

Description

Biological Functions and Mechanisms

Recombinant Macaca mulatta DARC serves as a model to study:

  • Chemokine scavenging: Binds inflammatory chemokines (e.g., CXCL8, CCL2) without initiating signal transduction, acting as a decoy receptor to regulate chemokine bioavailability .

  • Malaria pathogenesis: Facilitates Plasmodium vivax and P. knowlesi invasion via interaction with Duffy-binding proteins (DBPs) on merozoites .

  • Neuronal and endothelial roles: Localizes to Purkinje cells in the cerebellum and postcapillary venules, suggesting roles in neuroimmune crosstalk and leukocyte trafficking .

Functional Insights from Studies

  • Chemokine transcytosis: DARC internalizes chemokines in endothelial cells, enabling their apical presentation to circulating leukocytes .

  • Protective role in malaria: Duffy-negative individuals (lacking erythrocyte DARC) resist P. vivax infection but retain endothelial DARC expression, indicating tissue-specific functions .

Research Applications

Recombinant Macaca mulatta DARC is utilized in:

  1. Structural biology: Cryo-EM and X-ray crystallography to resolve binding interfaces with Plasmodium DBPs and chemokines .

  2. Drug discovery: Screening inhibitors targeting P. vivax invasion .

  3. Immune studies: Investigating chemokine buffering in inflammation and transplantation outcomes .

Notable Findings

  • DARC–chemokine interactions: Binds >20 chemokines with nanomolar affinity, validated via Scatchard analysis in chimeric receptors .

  • Cross-species conservation: Human chemokines bind murine and avian erythrocytes, highlighting evolutionary conservation of DARC’s chemokine-binding function .

Comparative Analysis with Human DARC

FeatureMacaca mulatta DARCHuman DARC (ACKR1)
Erythrocyte expressionLimitedAbsent in Duffy-negative individuals
Endothelial expressionUbiquitous in postcapillary venulesRetained in Duffy-negative individuals
Malaria receptorFunctional for P. knowlesiFunctional for P. vivax

Challenges and Future Directions

  • Functional redundancy: DARC’s role as a chemokine sink vs. transcytosis mediator remains debated .

  • Therapeutic targeting: Engineering DARC mutants to block Plasmodium invasion while preserving chemokine regulation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
ACKR1; DARC; FY; Atypical chemokine receptor 1; Duffy antigen/chemokine receptor; CD antigen CD234
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Macaca mulatta (Rhesus macaque)
Target Names
Target Protein Sequence
MGNCLHPAELSPSTQNSSQLNSDLWNFSYDGNDSFPDVDYDANLEAAAPCHSCNLLDDSA LPFFILVSVLGILASGTVLFMFFRPLFHWQLCPGWPVLAQLAVGSALFSIVVPILAPGLG NTRSSALCSLGYCVWYGSAFAQALLLGCHASLGPKLGAGQVPGLTLGLSVGLWGVAALLT LPITLASGASGGLCTPAYSMELKALQATHAVACLAVFVLLPLGLFGAKGLKKALGMGPGP WMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATP LLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSES
Uniprot No.

Target Background

Function

The Duffy antigen/chemokine receptor (DARC) is an atypical chemokine receptor that regulates chemokine levels and localization. It achieves this through high-affinity chemokine binding, which is decoupled from typical ligand-driven signal transduction. Instead, DARC facilitates chemokine sequestration, degradation, or transcytosis. Also known as an interceptor (internalizing receptor), chemokine-scavenging receptor, or chemokine decoy receptor, DARC exhibits promiscuous chemokine binding, interacting with inflammatory CXC and CC chemokines but not homeostatic chemokines. It binds to various chemokines, including CCL2, CCL5, CCL7, CCL11, CCL13, CCL14, CCL17, CXCL5, CXCL6, IL8/CXCL8, CXCL11, GRO, RANTES, MCP-1, and TARC. DARC regulates chemokine bioavailability and leukocyte recruitment via two mechanisms: when expressed in endothelial cells, it mediates abluminal-to-luminal transcytosis of tissue-derived chemokines, presenting them to circulating leukocytes; when expressed in erythrocytes, it serves as a blood reservoir and sink for chemokines, buffering fluctuations in plasma chemokine levels.

Database Links
Protein Families
G-protein coupled receptor 1 family, Atypical chemokine receptor subfamily
Subcellular Location
Early endosome. Recycling endosome. Membrane; Multi-pass membrane protein.

Q&A

What is Duffy antigen/chemokine receptor (DARC) in Macaca mulatta?

DARC in Macaca mulatta (Rhesus macaque) is a promiscuous chemokine receptor expressed in erythrocytes and endothelial cells. It functions as a binding protein for various chemokines and serves as a binding site for malarial parasites, similar to its human counterpart. The full-length protein consists of 335 amino acids with a molecular structure that includes transmembrane domains characteristic of chemokine receptors . The Rhesus macaque DARC shares significant sequence homology with human DARC, making it valuable for comparative studies in biomedical research .

How does Macaca mulatta DARC compare structurally to human DARC?

The Macaca mulatta DARC protein shares high sequence conservation with human DARC, particularly in the functionally critical amino terminal extracellular domain (E1), which is responsible for chemokine binding. This conservation reflects the evolutionary importance of DARC's chemokine binding function across species . The similarity in nucleotide sequence between human and non-human primate DARC homologues supports the conservation of this promiscuous chemokine binding function. This structural similarity is further evidenced by the high-affinity binding of human chemokines to murine and avian erythrocytes, suggesting functional conservation across diverse species .

What are the key functional domains of DARC?

Studies using chimeric receptors and monoclonal antibodies have localized the chemokine binding function to structures in the amino terminal extracellular domain (E1) . This has been demonstrated through Scatchard analysis of chimeric DARC receptors composed of the E1 domain of DARC and the hydrophobic helices and loops of interleukin-8RB (IL-8RB). These chimeric constructs bound IL-8 and MGSA with KD values nearly identical to wild-type receptors and maintained the characteristic binding profile for both C-X-C and C-C chemokines typical of DARC . The functional domains include:

DomainLocationPrimary Function
E1 (Extracellular)N-terminal regionChemokine binding, parasite recognition
Transmembrane domainsCentral protein regionStructural stability, membrane anchoring
Intracellular loopsCytoplasmic sideSignal transduction, protein interactions

Where is DARC typically expressed in Macaca mulatta tissues?

In Macaca mulatta, DARC expression follows a pattern similar to humans, with notable expression in erythrocytes and endothelial cells lining postcapillary venules, particularly in the kidney and spleen . Additionally, immunohistochemical studies have identified DARC expression in the central nervous system, specifically in the cerebellum. In human brain tissue, DARC has been localized to cell bodies and processes of Purkinje cells in the cerebellum, suggesting potential roles in the modulation of neuronal activity . This hierarchical expression pattern in neurons indicates that DARC may mediate interactions between glial cells and neurons through chemokine signaling pathways .

What techniques are most effective for detecting DARC expression in tissue samples?

Multiple complementary techniques can be employed for reliable detection of DARC expression:

  • Immunohistochemistry: Using monoclonal antibodies specific for DARC to visualize expression in fixed tissue sections. This approach has successfully identified DARC in Purkinje cells in the cerebellum .

  • Northern blotting: For detecting mRNA encoding DARC in various tissues, though interpretation may be complicated by DARC expression in postcapillary venules .

  • Chemokine binding assays: Radioligand binding and crosslinking with membranes prepared from tissue fractions can confirm the presence of functional DARC protein .

  • ELISA-based detection: Utilizing recombinant DARC protein as a standard for quantitative analysis of DARC expression levels .

What are the optimal storage conditions for recombinant Macaca mulatta DARC?

For recombinant Macaca mulatta DARC, proper storage is critical to maintain protein integrity and functionality. The recommended storage conditions are:

  • Store at -20°C for short-term storage

  • For extended storage, conserve at -20°C or -80°C

  • Utilize a Tris-based buffer with 50% glycerol optimized for protein stability

  • Avoid repeated freezing and thawing cycles as this may compromise protein integrity

  • Working aliquots can be stored at 4°C for up to one week

How can I optimize experimental protocols involving recombinant DARC?

To optimize experiments using recombinant Macaca mulatta DARC:

  • Buffer optimization: Use Tris-based buffers with glycerol that have been optimized for the specific protein to maintain stability during experiments .

  • Binding studies: When investigating chemokine binding, focus on the amino terminal extracellular domain (E1) as this region has been identified as critical for chemokine interactions .

  • Experimental design approach: Consider implementing Bayesian adaptive design methodologies similar to those used in the DARC toolbox for psychological experiments. Though designed for different applications, these principles of optimization can be applied to biochemical experiments to maximize information gain while minimizing experimental resources .

  • Data analysis: Employ statistical methods that account for the hierarchical nature of the data, especially when comparing DARC function across species or in different tissue types .

How does DARC function in the central nervous system of primates?

DARC expression in the central nervous system, particularly in Purkinje cells of the cerebellum, suggests important neurobiological functions . While chemokines like IL-8 are known to be expressed in the brain, presumably by glial cells, their role in normal or pathological nervous system physiology has been unclear due to difficulty identifying the cells expressing the corresponding receptors .

The discovery of DARC expression in Purkinje cells represents a significant advancement in understanding potential neuron-glia interactions mediated by chemokines. This hierarchical expression pattern suggests that DARC may play a crucial role in modulating neuronal activity through interactions with chemokines produced by glial cells . Research approaches to investigate this function include:

  • Electrophysiological studies of Purkinje cells in the presence of chemokines

  • Co-culture systems with DARC-expressing neurons and chemokine-producing glia

  • Comparative studies between human and Macaca mulatta DARC neuronal expression

What are the implications of DARC for malaria research in primate models?

DARC serves as a binding protein for the malarial parasite Plasmodium vivax, making it a critical component in malaria research . The genetic similarities between human and Macaca mulatta DARC make rhesus macaques potentially valuable models for studying malaria interactions, though specific differences in DARC structure may affect parasite binding efficiency.

When designing malaria research using Macaca mulatta:

  • Consider the population structure and genetic background of the macaques, as genetic variation can significantly influence research outcomes .

  • Compare binding efficiency of Plasmodium to DARC across different macaque populations to identify optimal models.

  • Incorporate knowledge of DARC's dual role as both chemokine receptor and parasite binding protein when interpreting results.

What expression systems are most appropriate for producing recombinant Macaca mulatta DARC?

The choice of expression system is critical for producing functional recombinant DARC. Consider these methodological approaches:

  • Mammalian expression systems: Preferred for maintaining proper post-translational modifications and folding of transmembrane proteins like DARC.

  • Insect cell systems: Can provide higher yields while maintaining many post-translational modifications.

  • Bacterial systems with optimization: While challenging for membrane proteins, can be used with fusion tags and solubilization strategies.

The expression system should be selected based on the intended experimental application, with mammalian systems typically providing the most native-like protein structure for functional studies.

How can I address challenges in studying the genetic background of DARC in primate models?

Understanding genetic variation in DARC across primate populations is essential for biomedical research, particularly when comparing results across studies. While the genetic background of Macaca mulatta is well-characterized with distinctions between Chinese and Indian populations, the genetic background of M. fascicularis is less characterized .

Methodological approaches to address this challenge include:

  • SNP analysis: Analyze RADseq-derived SNPs from samples representing the entire distribution range of the species to establish population genetics .

  • Admixture analysis: Investigate potential hybridization between closely related species that may affect DARC sequence and function .

  • Comparative genetics: Study the genetic relationships between M. fascicularis subspecies and between M. fascicularis and M. mulatta to contextualize DARC variation .

What statistical approaches are appropriate for analyzing DARC binding data?

For analyzing DARC binding data, researchers should consider:

  • Scatchard analysis: This approach has been successfully used to determine binding constants (KD values) for DARC interactions with chemokines like IL-8 and MGSA .

  • Bayesian methods: Consider implementing Bayesian statistical approaches that can incorporate prior knowledge about DARC binding characteristics to improve analysis precision .

  • Visual analytics systems: For complex multivariate data, consider adapting visualization approaches like those used in DARC visual analytics systems (though designed for different applications) to identify patterns in binding data .

How can I control for experimental variation in DARC studies?

Controlling for experimental variation is essential for reliable DARC research:

  • Genetic background consideration: Account for genetic variations in Macaca mulatta populations, as these can significantly influence experimental outcomes similar to observed differences between Chinese and Indian M. mulatta in disease progression and immunological response studies .

  • Standardized protocols: Implement rigorous standardization of experimental conditions, including buffer composition, temperature, and incubation times.

  • Internal controls: Include appropriate controls for each experiment, particularly when comparing DARC function across different species or tissue types.

  • Replicate design: Employ both technical and biological replicates to distinguish between experimental variation and true biological differences.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.