Recombinant Macaca mulatta Gap junction beta-2 protein (GJB2)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Macaca mulatta Gap Junction Beta-2 Protein (GJB2) is a genetically engineered form of connexin 26, a transmembrane protein critical for forming gap junctions. These intercellular channels facilitate the transfer of ions (e.g., potassium), small molecules (<1 kDa), and signaling mediators between adjacent cells . In Rhesus macaques (Macaca mulatta), GJB2 is structurally homologous to human connexin 26, sharing conserved roles in auditory function and epidermal homeostasis .

Research Applications

Recombinant Macaca mulatta GJB2 is widely used to study:

  • Gap Junction Dynamics: Mechanisms of channel assembly, trafficking, and intercellular communication .

  • Hearing Loss Pathogenesis: Mutations in GJB2 disrupt potassium recycling in the cochlea, leading to sensorineural deafness .

  • Skin Disorders: Aberrant epidermal differentiation linked to connexin 26 dysfunction .

  • Drug Development: Screening therapeutic agents targeting connexin-related channelopathies .

GJB2 Orthologs in Model Organisms

SpeciesKey FeaturesFunctional Insights
Human (Homo sapiens)Mutations cause DFNB1 (autosomal recessive deafness) and palmoplantar keratoderma .Dominant-negative mutations impair trafficking .
Mouse (Mus musculus)Used to model hearing loss; cochlear-specific knockout shows progressive deafness .Role in potassium homeostasis confirmed .
Gorilla (Gorilla gorilla)Structurally similar (98% AA identity); used for evolutionary studies .Limited clinical phenotype data .

Key Research Findings

  1. Trafficking Defects: Missense mutations (e.g., p.Ser183Phe) disrupt connexin 26 transport to the plasma membrane, causing cytoplasmic accumulation .

  2. Channel Functionality: Despite partial trafficking defects, mutant GJB2 retains limited dye-transfer capacity in vitro .

  3. Cochlear Expression:

    • GJB2 transcripts dominate in basal cells of the stria vascularis, critical for potassium ion regulation .

    • Co-localization with GJB6 (connexin 30) suggests specialized gap junction plaques with distinct permeability .

  4. Therapeutic Insights: CRISPR-Cas9 editing rescues GJB2 mutations in animal models, restoring auditory function .

Technical Considerations

  • Reconstitution: Requires sterile deionized water; glycerol (5–50%) recommended for long-term stability .

  • Functional Assays: Parachute dye-transfer assays (calcein) validate channel activity .

  • Limitations: Lack of post-translational modifications in prokaryotic systems may affect physiological relevance .

Future Directions

  • Gene Therapy: Adeno-associated virus (AAV) delivery of wild-type GJB2 to the inner ear .

  • Structural Biology: Cryo-EM studies to resolve mutation-induced conformational changes .

  • Multi-Species Comparisons: Evolutionary analysis of extracellular loop domains to identify conserved functional motifs .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag.
Synonyms
GJB2; Gap junction beta-2 protein; Connexin-26; Cx26
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Macaca mulatta (Rhesus macaque)
Target Names
Target Protein Sequence
MDWGALQTILGGVNKYSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGC KNVCYDHYFPISHIRLWALQLIFVSTPALLVAMHVAYRRHEKKRKFIKGEIKNEFKDIEE IKTQKVRIEGSLWWTYTSSIFFRVVFEAAFMYVFYVMYDGFSMQRLVKCNAWPCPNTVDC FVSRPTEKTVFTVFMIAVSGICILLNVTELCYLLIRYCSGKSKKPV
Uniprot No.

Target Background

Function
Gap junction beta-2 protein (GJB2) is a structural component of gap junctions. Gap junctions are dodecameric channels that connect the cytoplasm of adjacent cells. These channels are formed by the docking of two hexameric hemichannels, one from each cell membrane. Small molecules and ions diffuse from one cell to a neighboring cell through the central pore.
Database Links
Protein Families
Connexin family, Beta-type (group I) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

How does Macaca mulatta GJB2 protein compare to human GJB2?

Comparative analysis of Macaca mulatta and human GJB2 proteins reveals high conservation, reflecting their functional importance. While both proteins contain 226 amino acids, there are several specific differences in their sequences . This high degree of similarity makes rhesus macaque an excellent model for studying human hearing disorders related to GJB2 dysfunction.

When examining beta-2-microglobulin (a different protein but with similar comparative analytical approaches), researchers found that M. mulatta proteins differ from human and chimpanzee counterparts by approximately 8% (92% identity) . Similar comparative approaches can be applied to GJB2.

The sequence differences primarily occur in solvent-exposed regions rather than at protein interaction interfaces, suggesting that the functional domains involved in gap junction formation are highly conserved between species . This conservation emphasizes the translational relevance of studies using recombinant Macaca mulatta GJB2 protein for understanding human connexin biology and pathology.

How is recombinant Macaca mulatta GJB2 protein produced and purified?

Production of recombinant Macaca mulatta GJB2 protein typically involves the following methodological steps:

  • Gene cloning: The GJB2 gene sequence (1-226 amino acids) is amplified from Macaca mulatta genomic DNA or cDNA using PCR with specific primers . The PCR conditions often include: reaction volume of 25 μl, primers at 10 pM, template genomic DNA at 100 ng, with denaturation at 94°C for 5 min and 35 cycles of 94°C for 40 s, 53°C for 40 s, and 72°C for 55 s, followed by a 3-min final extension at 72°C .

  • Expression systems: Common expression systems include wheat germ cell-free systems (similar to those used for human GJB2) or bacterial expression systems like E. coli. For membrane proteins like GJB2, eukaryotic expression systems may better preserve protein folding and post-translational modifications.

  • Purification techniques: Purification typically involves affinity chromatography using protein tags (His-tag, GST, etc.), followed by size exclusion chromatography to isolate the properly folded protein .

  • Quality control: The purified protein is validated using SDS-PAGE, Western blotting, and mass spectrometry to confirm identity and purity .

For researchers requiring ready-made protein, commercial recombinant Macaca mulatta GJB2 protein is available for experimental applications including SDS-PAGE, ELISA, and Western blotting .

What is the role of GJB2 in hearing and deafness models?

GJB2 plays a critical role in inner ear function, particularly in the cochlea. In the inner ear, GJB2 forms gap junction channels that are essential for:

  • Potassium recycling: GJB2 channels help maintain the proper level of potassium ions in the inner ear, which is crucial for the conversion of sound waves to electrical nerve impulses .

  • Cellular maturation: GJB2 is required for the proper maturation of certain cells in the cochlea .

Mutations in the GJB2 gene are the most common genetic cause of non-syndromic hereditary deafness in humans, accounting for up to 50% of cases . Similarly, GJB2 mutations in Macaca mulatta can serve as models for human hearing loss, making recombinant GJB2 protein a valuable tool for studying the molecular mechanisms of deafness.

Research has shown that the pathogenicity of GJB2 mutations is often related to their impact on gap junction assembly and function. Mouse models carrying GJB2 mutations derived from human patients (such as 35delG and 235delC) have been developed to study the pathogenesis of GJB2-related deafness .

What experimental approaches are used to study GJB2 function in gap junctions?

Advanced researchers employ several sophisticated techniques to investigate GJB2 function in gap junctions:

  • Electrophysiological studies: Patch-clamp techniques are used to measure the electrical conductance properties of gap junctions formed by GJB2. These studies can assess how mutations affect channel permeability and gating .

  • Fluorescence recovery after photobleaching (FRAP): This technique measures the mobility and assembly of GJB2 proteins in living cells, providing insights into how mutations affect gap junction formation .

  • Cryo-electron microscopy: Used to determine the three-dimensional structure of GJB2 channels at near-atomic resolution, revealing how specific mutations disrupt channel architecture .

  • Dye transfer assays: These assays assess the permeability of gap junctions to specific dyes, providing information about channel selectivity and function. Small molecules and ions (typically <1,200 Da) can diffuse through these channels .

  • Transgenic animal models: Models like the conditional knock-out of GJB2 in specific tissues help understand its role in hearing and other physiological processes. For example, researchers have developed heterozygous Gjb2+/35delG and Gjb2+/235delC mutant mice to study GJB2-related hearing loss .

How can researchers design experiments to compare human and Macaca mulatta GJB2 proteins?

When designing comparative experiments between human and Macaca mulatta GJB2 proteins, researchers should consider the following methodological approaches:

  • Structural analysis: Conduct comparative structural analyses using molecular modeling or crystallography to identify differences in protein folding, particularly in the three solvent-exposed clusters that typically differ between species but don't involve contacts with binding partners .

  • Functional interchangeability studies: Test whether human and macaque GJB2 proteins can form functional gap junctions with the connexins of the other species. Similar studies with beta-2-microglobulin showed that human and macaque proteins could bind interchangeably with class I heavy chains of the other species .

  • Immunological cross-reactivity: Assess whether antibodies raised against human GJB2 recognize Macaca mulatta GJB2 with similar affinity, which can provide insights into structural conservation of epitopes .

  • Electrophysiological comparison: Compare the biophysical properties of gap junctions formed by human versus Macaca mulatta GJB2 using patch-clamp techniques to determine if there are species-specific differences in channel conductance or gating.

  • Molecular interaction studies: Use co-immunoprecipitation or proximity ligation assays to compare the interaction partners of human and Macaca mulatta GJB2, identifying conserved and divergent protein-protein interactions.

What techniques are used to investigate GJB2 mutations and their effects?

Researchers employ several techniques to study GJB2 mutations and their functional consequences:

  • DNA sequencing: Direct sequencing of the GJB2 coding region is the gold standard for identifying mutations. PCR amplification of the entire coding region (exon 2) can be performed using primers such as:

    • Forward primer: GTC TCC CTG TTC TGT CCT AG

    • Reverse primer: CTT CGA AGA TGA CCC GGA AG

  • Allele-specific PCR or restriction-enzyme digestion: These methods can be used to detect specific mutations like 35delG .

  • Genotype-phenotype correlation studies: These analyses assess the relationship between specific GJB2 mutations and the severity of hearing loss. For example, research has shown that biallelic GJB2 mutations can lead to varying degrees of hearing impairment, from moderate (11.6%) to severe (26.9%) or profound (61.5%) .

  • Haplotype analysis: SNP haplotyping can be used to trace the origin and spread of specific GJB2 mutations. For instance, analysis of haplotypes with the c.235delC mutation revealed one major haplotype (G A C T, 97.5%) in Eastern Asians and two haplotypes (G A C T, 71.4% and G A C C, 28.6%) in Northern Asians .

  • In vitro functional studies: These assess how specific mutations affect gap junction assembly, trafficking, and function using techniques such as immunofluorescence microscopy, electrophysiology, and dye transfer assays.

How can recombinant Macaca mulatta GJB2 be used in therapeutic development?

Recombinant Macaca mulatta GJB2 protein serves as a valuable tool in developing potential therapeutics for GJB2-related disorders:

  • High-throughput screening: The protein can be used in binding assays to screen compound libraries for molecules that interact with GJB2 or modulate its function.

  • Structure-based drug design: The three-dimensional structure of Macaca mulatta GJB2 can guide the design of small molecules that might correct the function of mutant GJB2 proteins.

  • Gene therapy testing: Before human trials, gene therapy approaches for GJB2-related hearing loss can be tested in rhesus macaque models, using the recombinant protein as a reference for successful expression and function .

  • Antibody development: Recombinant Macaca mulatta GJB2 can be used to develop and test therapeutic antibodies targeting extracellular domains of the protein.

  • Biomarker validation: The protein can serve as a standard in assays designed to detect GJB2 biomarkers in biological samples, helping assess the efficacy of therapeutic interventions.

Recent studies have identified potential biomarkers related to GJB2 function, including SERPINA3, ATP12A, and TOX3, which could serve as therapeutic targets for radiation-induced lung injury where GJB2 was found to be differentially expressed .

What challenges exist in working with recombinant connexin proteins like GJB2?

Researchers face several technical challenges when working with recombinant connexin proteins:

  • Membrane protein solubility: As transmembrane proteins, connexins like GJB2 are hydrophobic and difficult to maintain in solution without detergents or lipid environments.

  • Maintaining native conformation: Ensuring that recombinant GJB2 maintains its native folding and oligomerization properties is challenging, especially when expressed in heterologous systems.

  • Functional assessment: Verifying that recombinant GJB2 retains its functional properties as a gap junction channel requires sophisticated electrophysiological or dye transfer assays.

  • Species-specific differences: Even with 92% sequence identity between human and rhesus macaque proteins, the small differences may affect protein behavior in certain experimental contexts .

  • Post-translational modifications: Ensuring that recombinant GJB2 carries the appropriate post-translational modifications may require expression in mammalian systems rather than bacterial or wheat germ systems.

To address these challenges, researchers should consider using eukaryotic expression systems, membrane-mimetic environments for protein storage and handling, and rigorous functional validation of recombinant protein activity.

How should researchers design experiments using Macaca mulatta as a model for GJB2-related human disorders?

When designing experiments using Macaca mulatta to study GJB2-related disorders, researchers should consider:

  • Ethical considerations: Follow appropriate ethical guidelines for non-human primate research. Rhesus monkeys are used in nearly every area of biomedical research, including hearing loss studies, but researchers must adhere to strict ethical standards .

  • Sex-specific differences: Account for potential sex differences in GJB2 expression and function. Research on mice has shown profound differences in response to noise exposure between male and female subjects, suggesting similar sex-specific effects may exist in primates .

  • Age-related factors: Consider the age of the animals, as GJB2 expression and function may change throughout development and aging. This is particularly important for hearing studies, as age-related hearing loss could confound results .

  • Sample size determination: Use appropriate statistical methods to determine the minimum number of animals needed for robust results while minimizing animal use. For example, in RNA sequencing studies of lung samples, researchers used 3 lung regions from 4 irradiated non-survivor animals, 4 irradiated survivor animals, and 2 regions from 3 control animals .

  • Controls and validation: Include proper controls and validation steps, such as comparing GJB2 expression and function in normal versus pathological conditions, and validating findings from animal models against human clinical data.

What are the best methods for analyzing GJB2 expression and localization?

Researchers employ various techniques to analyze GJB2 expression and localization:

  • Quantitative PCR (qPCR): For measuring GJB2 mRNA expression levels. This technique requires careful selection of reference genes for normalization and appropriate primer design.

  • Western blotting: For quantifying GJB2 protein levels in tissue or cell lysates. Recombinant Macaca mulatta GJB2 protein can serve as a positive control .

  • Immunohistochemistry (IHC): For visualizing the spatial distribution of GJB2 in tissue sections. This technique requires optimization of fixation methods, antigen retrieval, and antibody dilutions.

  • Immunofluorescence microscopy: For higher-resolution imaging of GJB2 localization and co-localization with other proteins. This can reveal whether GJB2 properly localizes to gap junctions at the cell membrane.

  • RNA sequencing: For comprehensive analysis of GJB2 expression in the context of the whole transcriptome. RNA-seq has been used to identify differential expression of GJB2 in various conditions, such as radiation-induced lung injury .

  • Single-cell RNA sequencing: For analyzing cell-type-specific expression of GJB2, which is particularly valuable for heterogeneous tissues like the inner ear.

When comparing results across species or experimental conditions, it's crucial to use consistent methods and appropriate statistical analyses.

How can researchers effectively model GJB2 mutations found in human patients?

To effectively model human GJB2 mutations in research settings:

  • CRISPR/Cas9 gene editing: This approach can introduce specific GJB2 mutations identified in human patients into cell lines or animal models. For example, researchers have successfully created heterozygous Gjb2+/35delG and Gjb2+/235delC mutant mice through advanced androgenic haploid embryonic stem cell-mediated semi-cloning technology .

  • Conditional knockout models: These allow for tissue-specific or time-specific deletion of GJB2, which can be valuable for studying its role in specific contexts without causing embryonic lethality. The homozygous lethality of Gjb2 mutations in mice has been a challenge for creating perfect mouse models of human hereditary deafness .

  • Transgenic expression: Expressing human GJB2 mutations in model systems can reveal dominant-negative effects or gain-of-function mechanisms.

  • Patient-derived cells: Cells from patients with GJB2 mutations can be reprogrammed into induced pluripotent stem cells (iPSCs) and differentiated into relevant cell types for functional studies.

  • Ex vivo models: Tissue explants (e.g., cochlear cultures) can be manipulated to express or knockdown GJB2 to study its function in a more physiologically relevant context.

Each approach has advantages and limitations that should be considered based on the specific research questions. Combinations of these approaches often provide more robust insights than any single method alone.

How should researchers interpret differences between human and Macaca mulatta GJB2 function?

When interpreting differences between human and Macaca mulatta GJB2 function, researchers should consider:

  • Evolutionary context: Differences should be evaluated in the context of evolutionary conservation and divergence. Highly conserved regions likely have essential functions, while variable regions may reflect species-specific adaptations.

  • Functional significance: Assess whether differences affect critical functions like channel formation, permeability, or regulation. Structural analysis suggests that differences between human and rhesus macaque proteins often cluster in solvent-exposed regions rather than at protein-protein interfaces .

  • Translational implications: Consider how observed differences might affect the translation of findings from macaque models to human applications. The 92% identity between human and rhesus macaque beta-2-microglobulin suggests that studies in macaques can be relevant to human conditions, and similar principles may apply to GJB2 .

  • Technical variables: Rule out whether observed differences are due to technical variables (e.g., expression systems, assay conditions) rather than true biological differences.

  • Statistical validation: Ensure that observed differences are statistically significant and reproducible across multiple experiments and biological replicates.

What statistical approaches are recommended for analyzing GJB2 mutation data?

For rigorous analysis of GJB2 mutation data, researchers should employ these statistical approaches:

  • Genotype-phenotype correlations: Use regression analyses to assess relationships between specific GJB2 genotypes and phenotypic outcomes like hearing threshold. For example, studies have found that biallelic GJB2 mutations can lead to varying degrees of hearing impairment .

  • Population genetics statistics: Calculate allele frequencies, carrier rates, and Hardy-Weinberg equilibrium to understand the prevalence of GJB2 mutations in different populations. The carrier frequency of specific mutations like c.235delC has been compared across Asian populations using 95% confidence intervals based on binomial probability distribution .

  • Clustering analysis: Group GJB2 mutations based on their functional effects, location in the protein, or associated phenotypes to identify patterns.

  • Meta-analysis: Combine data from multiple studies to increase statistical power and identify consistent effects across different populations or experimental approaches.

  • Bayesian approaches: These can be particularly valuable when integrating diverse types of evidence about the functional impact of specific GJB2 variants.

For novel variants, prediction tools like PolyPhen and SNPs3D can help assess potential pathogenicity, though functional validation remains essential .

How can researchers integrate findings from different experimental approaches studying GJB2?

To effectively integrate findings from diverse experimental approaches:

  • Multi-omics integration: Combine data from genomics (GJB2 sequences), transcriptomics (expression levels), proteomics (protein interactions), and functional studies (electrophysiology) to build a comprehensive understanding of GJB2 biology.

  • Systems biology approaches: Use network analyses to place GJB2 in the context of broader cellular systems and pathways, identifying potential interactions and regulatory mechanisms.

  • Cross-species comparisons: Systematically compare findings from human, macaque, and other model systems to identify conserved mechanisms and species-specific differences.

  • Computational modeling: Develop mathematical models of gap junction function that can integrate experimental data and make predictions about system behavior under various conditions.

  • Collaborative databases: Contribute to and utilize shared databases of GJB2 variants and their functional effects, such as the connexin-deafness homepage (http://davinci.crg.es/deafness)[12].

Successful integration requires careful consideration of the strengths and limitations of each experimental approach, appropriate normalization of data from different sources, and robust statistical methods for combined analyses.

What are the key considerations when publishing research on recombinant Macaca mulatta GJB2 protein?

When publishing research on recombinant Macaca mulatta GJB2 protein, researchers should address:

  • Protein production and validation: Clearly describe the expression system, purification method, and validation techniques (SDS-PAGE, Western blot, mass spectrometry) used to confirm protein identity and purity .

  • Functional characterization: Provide evidence that the recombinant protein retains its native functional properties, such as the ability to form channels or interact with binding partners.

  • Sequence verification: Include the complete amino acid sequence or reference to repository accession numbers, and note any tags or modifications introduced during recombinant production .

  • Storage conditions: Specify optimal storage conditions for maintaining protein stability and activity, such as buffer composition, pH, and temperature. For example, some recombinant proteins are stored in Tris-based buffer with 50% glycerol at -20°C .

  • Application-specific validation: Demonstrate the suitability of the recombinant protein for specific applications (e.g., antibody production, functional assays, structural studies) with appropriate controls.

  • Ethical considerations: For research involving rhesus macaques, document compliance with ethical guidelines and institutional approvals .

Following these guidelines ensures reproducibility and facilitates the translation of findings to human applications.

What are emerging approaches for studying GJB2 function and dysfunction?

Emerging approaches for studying GJB2 include:

  • Organoid models: Three-dimensional inner ear organoids derived from stem cells offer promising systems for studying GJB2 function in a more physiologically relevant context than traditional cell culture.

  • Single-molecule imaging: Advanced microscopy techniques allow visualization of individual GJB2 molecules and their dynamics within living cells, providing insights into channel assembly and regulation.

  • Nanobody technology: Nanobodies (single-domain antibody fragments) can be designed to target specific domains of GJB2, offering new tools for protein detection and functional modulation with greater specificity than conventional antibodies.

  • Optogenetic control: Light-sensitive modules can be engineered into GJB2 to allow precise spatial and temporal control of channel function, enabling detailed studies of its role in cellular communication.

  • Machine learning approaches: These can help identify patterns in large datasets related to GJB2 mutations, expression, and function, potentially uncovering previously unrecognized relationships.

These approaches promise to enhance our understanding of GJB2 biology and may lead to novel therapeutic strategies for GJB2-related disorders.

How might comparative studies of GJB2 across species inform therapeutic development?

Comparative studies of GJB2 across species can inform therapeutic development in several ways:

  • Evolutionary conservation analysis: Identifying highly conserved regions across species can highlight domains essential for function that should be targeted or preserved in therapeutic interventions.

  • Natural compensation mechanisms: Some species may have evolved compensatory mechanisms for GJB2 dysfunction that could inspire therapeutic approaches. For example, studying how different species handle similar mutations might reveal resilience factors.

  • Pharmacological differences: Comparative studies can reveal species-specific responses to potential therapeutic compounds, helping predict human responses and optimize drug development.

  • Animal model selection: Understanding species differences in GJB2 structure and function can guide the selection of appropriate animal models for preclinical testing of GJB2-targeted therapies.

  • Biomarker discovery: Cross-species comparison of GJB2-related pathways may identify conserved biomarkers useful for monitoring disease progression and therapeutic efficacy.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.