Recombinant Macaca mulatta Melanin-concentrating hormone receptor 1 (MCHR1)

Shipped with Ice Packs
In Stock

Description

Biochemical and Functional Properties

MCHR1 mediates the orexigenic effects of melanin-concentrating hormone (MCH) and regulates energy homeostasis. Key functional aspects include:

Signaling Pathways

MCHR1 activates multiple downstream pathways through Gαi/o and Gαq coupling:

  • Calcium Mobilization: Intracellular Ca²⁺ flux via Gαq-mediated IP3 production .

  • cAMP Inhibition: Gi/o-dependent suppression of cAMP accumulation .

  • ERK Phosphorylation: MAP kinase activation linked to neuronal signaling .

PathwayMechanismBiological Role
Gαi/o-cAMPInhibits cAMP production via Gi/o proteinsModulates appetite and satiety
Gαq-Ca²⁺/IP3Activates phospholipase C, releasing Ca²⁺Regulates neuronal excitability
ERK ActivationPhosphorylates ERK via MAP kinase pathwaysInvolved in stress and reward signaling

Regulatory Modifications

Post-translational modifications critically influence receptor function:

  • Glycosylation: N-linked glycans at Asn23 are essential for cell surface trafficking and signaling .

  • Phosphorylation: C-terminal residues (e.g., Ser/Thr) mediate desensitization and internalization .

Research Applications and Pharmacological Studies

Recombinant MCHR1 is widely used in drug discovery and mechanistic studies:

Antagonist Development

MCHR1 antagonists (e.g., SNAP-94847) are explored for obesity treatment. Key findings include:

  • Binding Assays: Eu-MCH displacement assays quantify antagonist affinity (IC₅₀ values in nanomolar range) .

  • Cardiotoxicity Screening: hERG channel blockade testing prioritizes safe candidates like KRX-104130 .

AntagonistIC₅₀ (MCHR1)hERG IC₅₀Application
SNAP-948470.01–0.06 μM0.18–12.98 μMPreclinical obesity models
KRX-1041300.02 μM>50 μMPotential NASH therapeutic

Genetic and Functional Studies

  • Knockout Models: MCHR1 knockout mice exhibit reduced obesity susceptibility and hypermetabolism .

  • Mutant Analysis: R210H and P377S mutations abolish MCH binding, while others (e.g., S300T) alter signaling efficacy .

Production and Experimental Utility

Recombinant MCHR1 is produced via bacterial or mammalian expression systems, with applications in:

  • Structural Studies: NMR or X-ray crystallography to map ligand-binding pockets .

  • Functional Assays: Calcium flux, cAMP inhibition, and ERK phosphorylation measurements .

ApplicationMethodOutcome
Binding AffinityEu-MCH displacement assayQuantify antagonist potency
Signaling Pathway AnalysisLuciferase reporter (cAMP, Ca²⁺)Map G-protein coupling specificity
Protein PurificationNickel affinity chromatography (His-tag)Isolate >90% pure protein

Clinical and Translational Relevance

MCHR1 is a therapeutic target for metabolic and psychiatric disorders:

  • Obesity: Antagonists reduce food intake and improve insulin sensitivity .

  • Emotional Regulation: MCHR1 expression in the nucleus accumbens links it to stress and reward pathways .

  • Drug Repurposing: Machine learning identifies non-cardiotoxic MCHR1 antagonists for NASH treatment .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MCHR1; GPR24; Melanin-concentrating hormone receptor 1; MCH receptor 1; MCH-R1; MCHR-1; G-protein coupled receptor 24; MCH-1R; MCH1R; MCHR; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-388
Protein Length
full length protein
Species
Macaca mulatta (Rhesus macaque)
Target Names
Target Protein Sequence
ACAPGQGGRRWRLPQPAWVEGSSAWLWEPATGTGWMDLEASLLPTGPNTSNTSDGPDNLT SAGSPPRSGSVSYINIIMPSVFGTICLLGIIGNSMVIFAVVKKSKLHWCNNVPDIFIINL SVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLAT VHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDL YWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVF FVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLS VKPAAQGQLRAVSNAQTADEERTESKGT
Uniprot No.

Target Background

Function
Melanin-concentrating hormone receptor 1 (MCHR1) is a receptor for melanin-concentrating hormone, coupled to both G proteins that inhibit adenylyl cyclase and G proteins that activate phosphoinositide hydrolysis.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the optimal storage protocol for Recombinant Macaca mulatta MCHR1?

The shelf life and stability of Recombinant Macaca mulatta MCHR1 depend on multiple factors including storage state, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself. Optimal storage protocols differ based on preparation format:

  • Lyophilized form: Maintains stability for up to 12 months at -20°C/-80°C

  • Liquid form: Maintains stability for approximately 6 months at -20°C/-80°C

  • Working aliquots: Store at 4°C for up to one week only

Repeated freezing and thawing significantly reduces protein stability and functionality, so it is strongly recommended to prepare single-use aliquots upon initial reconstitution . For extended storage beyond 6 months, adding glycerol (typically to a final concentration of 50%) serves as a cryoprotectant to maintain protein integrity during freeze-thaw cycles .

What reconstitution procedure is recommended for lyophilized MCHR1?

For optimal reconstitution of lyophilized Recombinant Macaca mulatta MCHR1:

  • Briefly centrifuge the vial prior to opening to bring the contents to the bottom and prevent loss of product

  • Reconstitute using deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • For long-term storage, add glycerol to a final concentration of 5-50% (standard recommendation is 50%)

  • Prepare small working aliquots to minimize freeze-thaw cycles

  • Store reconstituted aliquots at -20°C/-80°C for long-term storage

The reconstitution buffer should be chosen based on downstream applications. While deionized sterile water is standard, specific buffer systems may be required for particular experimental setups.

What are the structural characteristics of Macaca mulatta MCHR1?

Macaca mulatta MCHR1 is a class A G protein-coupled receptor (GPCR) with the following key structural features:

  • Molecular weight: 42,777 Da

  • Amino acid length: 388 amino acids for the full-length protein

  • Transmembrane domains: Seven transmembrane helices typical of class A GPCRs

  • G-protein coupling preferences: Predominantly couples to inhibitory G protein (Gi/o)

  • Ligand binding configuration: Forms a binding pocket for MCH, with the peptide adopting a cysteine-mediated hairpin loop configuration

The receptor contains critical regions for ligand recognition, particularly the transmembrane domain (TMD) pocket that accommodates the central loop residues of MCH. The central arginine from the conserved LGRVY core motif (residues 9-13) inserts deeply into this pocket, which is crucial for receptor activation .

How can researchers evaluate the functional activity of recombinant MCHR1?

Functional validation of Recombinant Macaca mulatta MCHR1 requires multiple complementary approaches:

Binding Assays:

  • Radioligand binding assays using [125I]-MCH to determine binding affinity (Kd) and receptor density

  • Competition binding assays with unlabeled MCH or synthetic antagonists to evaluate ligand selectivity

Signaling Assays:

  • cAMP inhibition assays (as MCHR1 primarily couples to Gi/o proteins that inhibit adenylyl cyclase)

  • Calcium mobilization assays (for measuring Gq-mediated responses if coupling to multiple G proteins)

  • GTPγS binding assays to directly measure G protein activation

  • β-arrestin recruitment assays to evaluate receptor internalization

Functional Validation Criteria:

  • Dose-dependent responses to MCH peptide (EC50 values typically in the nanomolar range)

  • Specific antagonist blockade of MCH-induced responses

  • G-protein selectivity profiling (predominantly Gi/o over other G proteins)

  • Comparison with human MCHR1 to evaluate species-specific differences

When establishing these assays, it is crucial to use appropriate positive and negative controls, including cells transfected with empty vectors and stimulation with unrelated ligands.

What approaches can be used to study MCHR1 structure-function relationships?

Structure-function studies of MCHR1 can employ several complementary methodologies:

Mutational Analysis:

  • Alanine scanning mutagenesis of transmembrane domains to identify critical residues for ligand binding

  • Mutation of predicted key residues in the ligand binding pocket, particularly those interacting with the LGRVY core motif of MCH

  • Chimeric receptor construction (human-macaque hybrid receptors) to identify species-specific functional domains

Structural Biology Approaches:

  • Cryo-electron microscopy (cryo-EM) to determine the three-dimensional structure of MCHR1-G protein complexes

  • Molecular dynamics simulations based on resolved structures to understand conformational changes upon activation

  • Hydrogen-deuterium exchange mass spectrometry to map ligand-induced conformational changes

Functional Readouts:

  • Compare wild-type and mutant receptors using the following parameters:

    • Surface expression (flow cytometry or cell surface ELISA)

    • Ligand binding affinity

    • G-protein coupling efficiency

    • Ligand-induced receptor internalization rates

Recent structural studies have revealed that MCH adopts a consistent cysteine-mediated hairpin loop configuration when bound to receptors. The central arginine from the LGRVY core motif (residues 9-13) is particularly important as it penetrates deeply into the transmembrane pocket, triggering receptor activation .

What experimental controls should be included when working with Recombinant MCHR1?

Rigorous experimental design requires comprehensive controls when working with Recombinant Macaca mulatta MCHR1:

Protein Quality Controls:

  • SDS-PAGE analysis to confirm protein purity (should be ≥85%)

  • Western blot verification using anti-MCHR1 antibodies

  • Mass spectrometry to confirm protein identity and detect potential post-translational modifications

  • Circular dichroism to assess proper protein folding

Functional Controls:

  • Untransfected cell lines to establish baseline responses

  • Cells expressing known functional GPCRs (positive control for signaling assays)

  • Heat-inactivated MCHR1 preparations to control for non-specific effects

  • Dose-response curves with well-characterized MCHR1 ligands (both agonists and antagonists)

Specificity Controls:

  • Competitive binding with unlabeled ligands to confirm specificity

  • Structurally unrelated GPCRs to control for non-specific binding

  • Scrambled or mutated MCH peptides with altered LGRVY motifs

Procedural Controls:

  • Vehicle controls for all reagents used in functional assays

  • Time-course experiments to establish optimal incubation periods

  • Multiple biological replicates (minimum n=3) for statistical validity

How do Macaca mulatta and human MCHR1 differ functionally?

Comparative analysis between Macaca mulatta and human MCHR1 reveals important species-specific differences and similarities:

Sequence Homology:

Pharmacological Differences:

  • Binding affinity for MCH peptide is generally comparable between species

  • Some synthetic MCHR1 antagonists show species-specific binding profiles

  • Certain naturally occurring mutations in human MCHR1 can significantly alter pharmacological responses that may not be predictive in macaque models

Signaling Properties:

  • Both predominantly couple to Gi/o proteins

  • Human MCHR1 may exhibit broader G-protein coupling profiles in some cell contexts

  • Downstream signaling cascades are generally conserved between species

Research Implications:

  • Macaque MCHR1 provides a good translational model but is not identical to human MCHR1

  • Drug discovery programs should test compounds against both human and macaque receptors

  • Species-specific differences may impact interpretation of in vivo studies

  • Naturally occurring mutations in the human population should be considered when extrapolating from macaque models

How does MCHR1 differ from MCHR2 in structure and function?

Understanding the distinctions between MCHR1 and MCHR2 is crucial for targeted research:

G-Protein Coupling Preferences:

  • MCHR1: Predominantly couples to inhibitory G protein (Gi/o)

  • MCHR2: Exclusively couples to Gq/11

Signaling Pathways:

  • MCHR1: Primarily inhibits adenylyl cyclase, reducing cAMP levels

  • MCHR2: Activates phospholipase C, increasing intracellular calcium

  • Both can activate multiple downstream signaling cascades

Structural Differences:

  • Both are class A GPCRs with seven transmembrane domains

  • Key differences in the binding pocket accommodate similar ligands with different signaling outcomes

  • Divergent intracellular loops, particularly ICL3, account for different G-protein coupling specificities

Ligand Recognition:

  • Both receptors bind MCH with the ligand adopting a similar cysteine-mediated hairpin loop configuration

  • The central arginine from the LGRVY core motif is essential for activating both receptors

  • Subtle differences in binding pocket architecture may explain G-protein coupling selectivity

Therapeutic Implications:

  • MCHR1 antagonists are primarily explored for obesity treatment

  • MCHR1 antagonists also show promise for treating anxiety and depression

  • Designing selective compounds requires understanding the structural basis for these differences

What are common issues in expression systems for Recombinant MCHR1 and how can they be addressed?

Researchers frequently encounter challenges when expressing Recombinant Macaca mulatta MCHR1:

Expression System Selection:

Expression SystemAdvantagesLimitationsBest Applications
E. coliCost-effective, high yieldLimited post-translational modifications, inclusion body formationPartial protein domains, peptide fragments
Mammalian cellsNative-like processing, proper foldingHigher cost, lower yieldFull-length functional studies, signaling assays
Insect cellsHigher yield than mammalian, some PTMsNot all mammalian PTMsStructural studies requiring larger protein quantities
Cell-free systemsRapid, avoids cellular toxicityExpensive, limited scalabilityQuick screening, toxic protein production

The search results indicate that E. coli is commonly used for producing partial MCHR1 proteins with sufficient purity (>85% by SDS-PAGE) .

Common Expression Challenges:

  • Low expression levels: Optimize codon usage for expression system and use stronger promoters

  • Protein misfolding: Lower induction temperature, use fusion tags (SUMO, MBP, etc.)

  • Toxicity to host cells: Use tightly regulated inducible systems, lower expression levels

  • Inclusion body formation: Optimize solubilization and refolding protocols using chaotropic agents

  • Protein instability: Include protease inhibitors and optimize buffer conditions

Validation Strategies:

  • Confirm expression using Western blot with tag-specific or MCHR1-specific antibodies

  • Assess membrane localization in mammalian systems using cell-surface biotinylation

  • Verify functionality through ligand binding assays before proceeding to downstream applications

What are the key considerations for designing MCHR1-based experiments in Macaca mulatta models?

When designing in vivo experiments using Macaca mulatta models focusing on MCHR1:

Experimental Design Factors:

  • Baseline characterization: Establish normal MCHR1 expression patterns in relevant tissues

  • Age and sex considerations: Account for hormonal and developmental influences on MCHR1 expression

  • Ethical considerations: Follow 3Rs principles (Replacement, Reduction, Refinement) and appropriate regulatory guidelines

  • Sample collection timing: MCHR1 expression may follow circadian patterns requiring standardized collection times

Physiological Considerations:

  • Body weight and food intake measurements should be performed at consistent times

  • Standardized environmental conditions are crucial as stress can affect MCH signaling

  • Consider potential drug interactions with endogenous hormonal systems

  • Account for individual variation by using sufficient group sizes for statistical power

Methodological Approaches:

  • CSF sampling for measuring endogenous MCH levels

  • PET imaging with radiolabeled ligands for receptor occupancy studies

  • Metabolic assessments including glucose tolerance tests

  • Behavioral assessments relevant to MCH function (feeding, anxiety, sleep)

Data Interpretation Challenges:

  • Distinguishing direct MCHR1-mediated effects from secondary physiological responses

  • Accounting for compensatory mechanisms in chronic studies

  • Translating findings to human applications

  • Standardizing reporting to enhance cross-study comparability

A meta-analysis of rhesus macaque studies highlighted significant variability in experimental design and reporting, which complicates cross-study comparisons. Standardization of experimental protocols is essential for advancing understanding of MCHR1 functions in primate models .

How can Recombinant MCHR1 be utilized for drug discovery and development?

Recombinant Macaca mulatta MCHR1 serves as a valuable tool in the drug discovery pipeline:

Primary Screening Applications:

  • High-throughput screening assays using MCHR1-expressing cell lines to identify novel ligands

  • Binding displacement assays to determine affinity of drug candidates

  • Functional assays to distinguish between agonists, antagonists, and allosteric modulators

  • Species comparison studies to identify compounds with consistent pharmacology across species

Lead Optimization Support:

  • Structure-activity relationship studies guided by receptor-ligand interaction data

  • Evaluation of off-target effects on related GPCRs

  • Assessment of receptor selectivity profiles

  • Species selectivity profiling to support translational research

Advanced Drug Development:

  • PK/PD relationship studies correlating plasma drug levels with receptor occupancy

  • Mechanism of action confirmation through signaling pathway analysis

  • Receptor residence time studies to optimize compound binding kinetics

  • Discovery of biased ligands selectively activating beneficial signaling pathways

Therapeutic Target Areas:

  • Obesity and metabolic disorders (primary focus for MCHR1 antagonists)

  • Anxiety and depression (emerging application)

  • Sleep disorders

  • Potential challenges include off-target effects on human ether-a-go-go-related gene (hERG) channels

What emerging techniques are advancing our understanding of MCHR1 structure and function?

Cutting-edge methodologies are transforming MCHR1 research:

Advanced Structural Biology:

  • Cryo-electron microscopy has recently revealed the three-dimensional structure of MCH-activated MCHR1 with Gi protein at 3.01 Å resolution

  • These structural insights show that MCH adopts a cysteine-mediated hairpin loop configuration when bound to the receptor

  • The central arginine from the LGRVY core motif penetrates deeply into the transmembrane pocket, triggering receptor activation

Genetic Engineering Approaches:

  • CRISPR/Cas9 gene editing to create precise receptor mutations or knockout models

  • Knockin models expressing fluorescently tagged receptors for live imaging

  • Conditional expression systems to study tissue-specific effects

Single-Cell Analysis:

  • Single-cell RNA sequencing to map MCHR1 expression across cell populations

  • Spatial transcriptomics to understand regional distribution in complex tissues

  • Mass cytometry to correlate MCHR1 expression with cellular phenotypes

Computational Methods:

  • Molecular dynamics simulations based on cryo-EM structures

  • AI-driven prediction of ligand binding and efficacy

  • Systems biology approaches integrating MCHR1 into broader metabolic networks

Translational Biomarkers:

  • Development of PET tracers for non-invasive imaging of MCHR1 occupancy

  • Identification of downstream biomarkers of receptor activation

  • Correlation of genetic variants with treatment responsiveness

Recent structural studies have provided unprecedented insights into MCH recognition by MCHR1. The receptor-ligand complex reveals that MCH adopts a γ-shaped configuration, with the central 10 residues forming a cyclic loop with a disulfate bond. These structural details offer a foundation for structure-based drug design targeting specific receptor-ligand interactions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.