Recombinant Macaca mulatta Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Macaca mulatta MC1R

Recombinant Macaca mulatta Melanocyte-Stimulating Hormone Receptor (MC1R) is a genetically engineered protein produced to study the molecular mechanisms of pigmentation, receptor signaling, and evolutionary adaptations in primates. This full-length receptor is synthesized in E. coli systems, tagged with a hexahistidine (His) sequence for purification, and lyophilized for stability .

Pigmentation and UV Response Studies

  • MC1R activation by α-melanocyte-stimulating hormone (α-MSH) triggers cAMP signaling, upregulating eumelanin production . Loss-of-function mutations increase pheomelanin, elevating UV sensitivity and melanoma risk .

  • In Sulawesi macaques, reduced basal cAMP activity in MC1R variants (e.g., M. hecki) aligns with darker coats, highlighting natural selection pressures .

Biomedical Relevance

  • Melanoma Research: MC1R polymorphisms are linked to melanoma susceptibility, making recombinant MC1R vital for screening therapeutic agents .

  • Evolutionary Biology: Fixed non-synonymous substitutions in MC1R among Macaca species provide insights into rapid speciation and adaptive traits .

Technical Advantages of Recombinant MC1R

  • High Stability: Lyophilized formulation retains activity after reconstitution, enabling long-term storage .

  • Functional Assays: Used in in vitro cAMP assays to quantify ligand efficacy and receptor desensitization .

Comparative Genomic Context

  • Rhesus macaques (Macaca mulatta) exhibit lower genome-wide recombination rates than humans, influencing linkage disequilibrium studies of MC1R and pigmentation traits .

  • Copy number variation analyses in 198 rhesus macaques identify conserved duplications near MC1R, underscoring its evolutionary constraint .

Future Directions

  • Mechanistic Studies: Resolving MC1R dimerization dynamics and domain-swapping mechanisms .

  • Therapeutic Development: Targeting MC1R signaling pathways for melanoma prevention or pigmentary disorders .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery times may vary depending on the purchase method or location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Macaca mulatta (Rhesus macaque)
Target Names
Target Protein Sequence
MPVQGSQRRLLGSLNSTPTATPHLGLAANQTGARCREVSIPDGLFLSLGLVSLVENVLVV TAIAKNRNLHSPMYCFICCLALSDLLVSGSNMLETAVTLLLEAGALVARAAVVQQLDNVI DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRAQRAIAAIWVASVLCSTLFI AYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRLAHQGFGLKGA ATLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLALIICNAIIDPLIYAF RSQELRRTLKEVLLCSW
Uniprot No.

Target Background

Function
This receptor is responsible for binding to MSH (alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins that activate adenylate cyclase. It plays a crucial role in melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by regulating cAMP signaling in melanocytes.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the adrenal gland.

Q&A

What is the functional significance of MC1R in Macaca mulatta?

MC1R in Macaca mulatta, like other macaque species, plays a key role in regulating melanin production, specifically controlling the balance between eumelanin (brown/black pigments) and pheomelanin (red/yellow pigments). Research indicates that MC1R in catarrhines, including M. mulatta, displays strong functional conservation with dose-dependent α-MSH binding and high basal activity . This conservation suggests an important evolutionary role in maintaining pigmentation patterns in these primates. Unlike some other species where MC1R variations lead to dramatic color changes, the functional properties of MC1R in macaques appear to be more constrained, potentially due to selective pressures.

How does MC1R sequence diversity in Macaca mulatta compare to other macaque species?

Comparative studies have shown that MC1R nucleotide diversity in Macaca mulatta is relatively higher compared to Sulawesi macaques but similar to M. fascicularis. Specifically, M. mulatta and M. fascicularis show approximately three times higher diversity (π ≈ 0.20 × 10^-2) compared to Sulawesi macaques (π ≈ 0.067 × 10^-2) . This pattern suggests different evolutionary pressures across macaque species, with some Sulawesi macaques showing evidence of purifying selection for dark coat color. The higher diversity in M. mulatta indicates potentially more relaxed constraints on MC1R function or greater population variation.

What is the basal activity profile of Macaca mulatta MC1R?

M. mulatta MC1R exhibits high basal (constitutive) activity, similar to its close relative M. nemestrina. Research has demonstrated that M. nemestrina MC1R shows the highest basal activity among phylogenetically diverse primate species studied . This high constitutive activity means that the receptor can signal and stimulate cAMP production even without agonist binding, which has implications for pigmentation patterns. When designing experiments with recombinant M. mulatta MC1R, researchers should account for this high basal activity by including appropriate negative controls and baseline measurements in functional assays.

What are the key structural domains of MC1R important for function in macaques?

The MC1R protein contains several functional domains that are critical for its activity. Based on research in macaques, these include:

DomainPositionFunctional Significance
N-terminal1-25Contains sites for post-translational modifications
Transmembrane 1 (TM1)26-50Important for receptor stability
Extracellular Loop 1 (EL1)51-100Contains sites for ligand binding
Intracellular Loop 2 (IL2)101-120Important for G-protein coupling
Transmembrane 5 (TM5)150-175Critical for receptor activation
Extracellular Loop 3 (EL3)195-210Involved in ligand recognition
Transmembrane 7 (TM7)260-280Contains key residues for signal transduction
C-terminal290-317Important for receptor internalization

Functional studies have identified specific amino acid positions within these domains that are critical for MC1R activity in macaques . When creating recombinant MC1R constructs, ensuring the integrity of these domains is essential for maintaining physiological function.

How do functional assays for recombinant M. mulatta MC1R differ from those used for other species?

Functional characterization of recombinant M. mulatta MC1R requires specialized approaches due to its high basal activity. While the core methodology for measuring MC1R function across species involves cAMP assays (as MC1R signals primarily through Gs proteins), specific considerations for M. mulatta include:

  • Basal activity measurements: Due to the high constitutive activity of macaque MC1R, establishing accurate baseline measurements is critical. This requires careful optimization of receptor expression levels to avoid system saturation.

  • Dose-response curves: M. mulatta MC1R shows dose-dependent responses to α-MSH with EC50 values similar to M. nemestrina (approximately 0.7 nM) . Researchers should design experiments with an appropriate concentration range (typically 10^-10 to 10^-6 M) to capture the full dose-response relationship.

  • Expression systems: HEK293 cells are commonly used for functional characterization of macaque MC1R, but expression levels must be carefully controlled to avoid artifacts from overexpression.

  • Readout systems: While various cAMP detection methods exist, ELISA-based assays and luminescence-based reporter systems have been successfully used for macaque MC1R studies .

When comparing results across species, normalization approaches should account for differences in basal activity to accurately assess relative responses to agonists.

What site-directed mutagenesis approaches are most effective for studying MC1R structure-function relationships in macaques?

Site-directed mutagenesis has been invaluable for understanding the functional consequences of specific amino acid substitutions in MC1R. Based on research with macaque MC1R, effective approaches include:

  • Target selection: Focus on evolutionarily conserved residues identified through comparative sequence analysis. SIFT (Sorting Intolerant From Tolerant) and PROVEAN (Protein Variation Effect Analyzer) analyses have successfully identified functionally significant substitutions in macaque MC1R .

  • Substitution strategy: Design mutations that:

    • Revert species-specific substitutions to ancestral states

    • Exchange residues between species with different functional profiles

    • Alter specific biochemical properties (charge, hydrophobicity)

  • Validation methodology: Comprehensive functional characterization should include:

    • Basal activity measurements

    • Complete dose-response curves with α-MSH

    • Surface expression quantification

    • Binding affinity determinations when possible

Research with Sulawesi macaques has demonstrated the effectiveness of this approach, where mutants like M. nigra_G304E, M. tonkeana_S104G, and M. hecki_Y267C showed significant changes in basal activity and agonist responsiveness compared to wild-type receptors .

What are the key considerations when designing α-MSH binding experiments with recombinant M. mulatta MC1R?

Alpha-MSH binding experiments with recombinant M. mulatta MC1R require careful consideration of several factors:

  • Receptor expression: Consistent and physiologically relevant expression levels are critical. Inducible expression systems can help control receptor density on the cell surface.

  • Binding conditions: Optimal conditions include:

    • Temperature: 37°C for physiological relevance

    • Incubation time: 1-2 hours to reach equilibrium

    • Buffer composition: Physiological pH (7.4) with appropriate ions

  • Ligand considerations:

    • Use of labeled α-MSH (radioactive or fluorescent)

    • Concentration range spanning at least 3 orders of magnitude around the expected EC50

    • Inclusion of non-specific binding controls

  • Data analysis:

    • Scatchard analysis or non-linear regression to determine Kd values

    • Comparison of binding parameters with functional outcomes (cAMP production)

How can evolutionary analyses of MC1R inform functional studies of recombinant M. mulatta MC1R?

Evolutionary analyses provide critical context for interpreting functional studies of recombinant M. mulatta MC1R:

  • Selection pressure analysis: Using models like those in the PAML package (branch, site, and branch-site models) can identify sites under positive or purifying selection . For M. mulatta MC1R, understanding the selective pressures can inform which residues are likely to be functionally critical.

  • Ancestral sequence reconstruction: Reconstructing ancestral MC1R sequences allows for:

    • Identification of derived substitutions specific to M. mulatta

    • Creation of ancestral MC1R constructs as functional reference points

    • Testing hypotheses about functional evolution through comparative assays

  • Comparative functional genomics: Integrating functional data across species with phylogenetic relationships can reveal:

    • Parallel evolution in MC1R function

    • Lineage-specific functional adaptations

    • Correlation between MC1R function and phenotypic traits

Research in macaques has shown that MC1R appears to be under purifying selection in most primate lineages, including the ancestral lineage of macaques and the silenus group . This evolutionary context suggests that maintaining MC1R function has been important throughout primate evolution, with species-specific adaptations overlaid on this conserved framework.

What expression systems are optimal for producing functional recombinant M. mulatta MC1R?

For optimal expression of functional recombinant M. mulatta MC1R, several expression systems have been validated:

  • Mammalian cell systems:

    • HEK293 cells: Most commonly used for functional studies due to low endogenous expression of MC1R and appropriate post-translational modification machinery.

    • COS-7 cells: Useful for immunolocalization studies due to their large, flat morphology.

    • CHO cells: Valuable for stable expression and large-scale production.

  • Expression vector considerations:

    • Promoter selection: CMV promoters provide high expression levels suitable for most functional assays.

    • Tags: C-terminal tags (FLAG, His, HA) are preferable to N-terminal tags, which can interfere with signal peptide function.

    • Codon optimization: While not always necessary for expression in mammalian cells, can improve yields.

  • Transfection/transduction methods:

    • Lipid-based transfection: Efficient for transient expression in most cell types.

    • Viral vectors: Useful for difficult-to-transfect cells or in vivo studies.

    • Stable cell line generation: Recommended for long-term or high-throughput studies.

  • Quality control measures:

    • Western blotting to confirm expression at expected molecular weight

    • Cell surface ELISA or flow cytometry to quantify surface expression

    • Functional validation through cAMP assays

In studies with macaque MC1R, HEK293 cells with lipid-based transfection have proven effective for functional characterization, providing consistent expression levels suitable for comparative analyses across species and mutant variants .

What are the most reliable methods for quantifying cAMP responses in MC1R functional assays?

Reliable quantification of cAMP responses is critical for characterizing MC1R function. Based on research with macaque MC1R, the following methods have proven effective:

  • Direct cAMP measurement techniques:

    • Enzyme immunoassay (EIA): High sensitivity, suitable for detecting small changes in basal activity.

    • Radioimmunoassay (RIA): Historically used, offering good sensitivity but declining in use due to radioactivity concerns.

    • HPLC-MS/MS: Highly specific and sensitive, but requires specialized equipment.

  • Reporter-based assays:

    • CRE-luciferase reporters: Allow real-time monitoring of cAMP-dependent transcriptional activation.

    • FRET/BRET-based sensors: Enable real-time, live-cell measurements of cAMP dynamics.

    • GloSensor™ technology: Provides high sensitivity and temporal resolution.

  • Experimental design considerations:

    • Include phosphodiesterase inhibitors (e.g., IBMX) to prevent cAMP degradation.

    • Establish complete dose-response curves (10^-11 to 10^-6 M α-MSH).

    • Include positive controls (forskolin) and negative controls (vehicle, untransfected cells).

    • Normalize data appropriately (percent of maximum response, fold over basal).

  • Data analysis approaches:

    • Calculate EC50 values using non-linear regression.

    • Compare both maximal responses and EC50 values across variants.

    • Apply appropriate statistical tests (ANOVA with post-hoc tests, t-tests with correction for multiple comparisons).

Studies on Sulawesi macaque MC1R have successfully employed these approaches to detect significant functional differences between species variants and to characterize the effects of specific mutations .

How should researchers design experiments to distinguish between MC1R basal activity and agonist-induced responses?

Distinguishing between basal activity and agonist-induced responses is particularly important for macaque MC1R, which exhibits high constitutive activity. Effective experimental designs include:

  • Basal activity measurement:

    • Measure cAMP production in cells expressing MC1R without any agonist stimulation.

    • Compare to cells transfected with empty vector to account for endogenous cAMP production.

    • Include multiple receptor expression levels to establish relationship between receptor density and basal activity.

  • Agonist-induced response characterization:

    • Full dose-response curves (typically 10^-11 to 10^-6 M α-MSH).

    • Calculate both absolute cAMP levels and fold-increase over basal.

    • Report both EC50 values and maximum responses (Emax).

  • Inverse agonist studies:

    • Include inverse agonists (e.g., agouti signaling protein) to reduce basal activity.

    • Quantify the degree of constitutive activity by measuring the maximal inhibition by inverse agonists.

  • Experimental controls:

    • Positive controls: Forskolin (direct adenylyl cyclase activator)

    • Negative controls: Untransfected cells, receptor-negative cell lines

Research with macaque MC1R has employed these approaches to reveal significant species differences in both basal activity and agonist-induced responses. For example, while M. nemestrina MC1R shows high basal activity (ΔF/ΔF = 0.374 ± 0.026), other macaque species like M. nigra show significantly lower basal cAMP levels . These differences have functional implications for melanin production and coat color.

What approaches are effective for analyzing MC1R sequence evolution across macaque species?

Effective approaches for analyzing MC1R sequence evolution across macaque species include:

  • Sequence acquisition and alignment:

    • PCR amplification and sequencing of the complete MC1R coding region (typically ~954 bp).

    • Multiple sequence alignment using MUSCLE or MAFFT algorithms.

    • Manual verification of alignments, particularly around insertion/deletion regions.

  • Diversity and polymorphism analysis:

    • Calculate nucleotide diversity (π) within species.

    • Identify fixed differences between species.

    • Distinguish synonymous from non-synonymous substitutions.

  • Selection analysis:

    • Site-specific selection tests (PAML site models) to identify codons under positive selection.

    • Branch-specific tests to detect lineage-specific selection pressures.

    • Branch-site tests to identify sites under selection in specific lineages.

    • Complementary approaches: FUBAR, MEME, SLAC, FEL from the HyPhy package.

  • Functional prediction:

    • SIFT analysis to predict whether substitutions are tolerated.

    • PROVEAN analysis to assess functional impact of amino acid variations.

    • Structure-based predictions using homology models.

  • Ancestral sequence reconstruction:

    • Maximum likelihood or Bayesian approaches to infer ancestral sequences at internal nodes.

    • Assessment of confidence in ancestral reconstructions.

Research on macaque MC1R has employed these methods to reveal patterns of evolution and selection. For example, studies have shown that MC1R in M. nigra and M. nigrescens underwent purifying selection, consistent with their dark coat color, while detecting specific substitutions in each species that correspond with functional differences .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.