Recombinant Macaca mulatta Mu-type opioid receptor (OPRM1)

Shipped with Ice Packs
In Stock

Description

Production Methods

Recombinant OPRM1 is synthesized using heterologous expression systems:

Common Expression Platforms

SystemExample Products (Source)Yield/Purity
E. coliCSB-CF842565MOV , RPC27440 >85% purity
Mammalian CellsCSB-MP842565MOV1 Functional GPCRs
Baculovirus (Insect)CSB-BP842565MOV1 High glycosylation

Tagging: Most constructs include N-terminal His-tags (e.g., 10×His) or fluorescent tags (eYFP) for purification/tracking .

Key Research Applications

  • Ligand Binding: Binds β-endorphin, morphine, and fentanyl with K<sub>d</sub> values comparable to human OPRM1 .

  • Signaling: Couples to Gα<sub>i/o</sub> proteins, inhibiting cAMP production and modulating potassium/calcium channels .

  • Genetic Polymorphisms: The C77G variant alters infant-mother attachment behaviors in rhesus macaques .

Table: Functional Comparisons of OPRM1 Variants

VariantSpeciesPhenotypic EffectSource
C77GRhesus macaqueIncreased maternal restraint of infants
A118GHumanAltered pain perception, addiction risk

Technical Considerations

  • Storage: -80°C in glycerol-containing buffers; avoid freeze-thaw cycles .

  • Activity Assays: Use GTPγS binding or BRET/FRET-based systems to validate G-protein coupling .

  • Species Specificity: Rhesus OPRM1 shows 98% homology to mouse but differs in promoter regions affecting gene regulation .

Research Limitations

  • Glycosylation Differences: Bacterial systems (e.g., E. coli) lack post-translational modifications present in mammalian cells .

  • Polymorphism Gaps: Most commercial proteins lack the C77G variant, limiting studies on maternal behavior .

Emerging Applications

  • AAV-Driven Expression: Humanized OPRM1 promoters enable cell-type-specific modulation in primate models .

  • Opioid Alternatives: Used to screen biased agonists (e.g., PZM21) with reduced respiratory side effects .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
OPRM1; MOR1; Mu-type opioid receptor; M-OR-1; MOR-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-400
Protein Length
full length protein
Species
Macaca mulatta (Rhesus macaque)
Target Names
Target Protein Sequence
MDSSAVPTNASNCTDALAHSSCSPARSPGSWVNLSHLDGNLSDPCGPNRTDLGGRDSLCP PTGSPSMITAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALVT STLPFQSVNYLMGTWPFGTILCKIVISIDYYNMSTSIFTLCTMSVDRYIAVCHPVKALDF RTPRNAKIINVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPSWYWENLLKICVFI FAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIICWTPIHI YVIIKALVTIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDEDFKRCFREFCIPTSSNI EQQNSTRIRQNTRDHPSTANTVDRTNHQLENLEAETAPLP
Uniprot No.

Target Background

Function

The mu-type opioid receptor (OPRM1) is a receptor for endogenous opioids like beta-endorphin and endomorphin, as well as for various natural and synthetic opioids including morphine, heroin, DAMGO, fentanyl, etorphine, buprenorphine, and methadone. Agonist binding initiates coupling to an inactive, GDP-bound heterotrimeric G-protein complex. This leads to GDP/GTP exchange in the G-protein alpha subunit, causing complex dissociation. The free GTP-bound G-protein alpha subunit and the G-protein beta-gamma dimer then activate downstream effectors. Activity is predominantly coupled to pertussis toxin-sensitive G(i) and G(o) G alpha proteins (GNAI1, GNAI2, GNAI3, and GNAO1), and to a lesser extent, to pertussis toxin-insensitive G alpha proteins (GNAZ and GNA15). These interactions mediate diverse cellular responses, including inhibition of adenylate cyclase and N-type/L-type calcium channels, activation of inward rectifying potassium channels, and modulation of MAPK, PLC, PKC, PI3K, and NF-kappa-B. OPRM1 also couples to adenylate cyclase stimulatory G alpha proteins. The temporal coupling to G-proteins and subsequent signaling is regulated by RGSZ proteins (e.g., RGS9, RGS17, RGS4). Phosphorylation by GPRK family Ser/Thr protein kinases and beta-arrestin association mediate short-term receptor desensitization. Beta-arrestins uncouple the receptor from G-proteins, terminating signal transduction, and facilitate receptor internalization via clathrin-coated pits. ERK pathway activation occurs through G-protein-dependent or beta-arrestin-dependent mechanisms, regulated by agonist-specific receptor phosphorylation. OPRM1, a class A GPCR, dissociates from beta-arrestin near the plasma membrane and undergoes rapid recycling. Down-regulation pathways vary depending on the agonist and can be G-protein-dependent or -independent. Endogenous ligands induce rapid desensitization, endocytosis, and recycling. Heterooligomerization with other GPCRs can modulate agonist binding, signaling, and trafficking. OPRM1 is also implicated in neurogenesis.

Gene References Into Functions
  1. A nonsynonymous SNP in OPRM1's first exon (OPRM1 A118G), encoding the ligand-binding domain, is associated with increased alcohol-induced stimulation and euphoria. PMID: 27484010
  2. Coactivation of mu opioid and nociceptin receptors produces synergistic antinociception. PMID: 22743574
  3. OPRM1 variation is associated with social attachment and rejection. PMID: 21463018
  4. OPRM1 gene variation influences hypothalamic-pituitary-adrenal axis function in response to stressors. PMID: 21459516
  5. OPRM1 variation plays a role in attachment behavior, particularly following caregiver separation. PMID: 18378897
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, axon. Perikaryon. Cell projection, dendrite. Endosome.

Q&A

What is the Macaca mulatta Mu-type opioid receptor (OPRM1) and why is it important in research?

The Macaca mulatta Mu-type opioid receptor (OPRM1) is a G-protein coupled receptor that plays a critical role in the endogenous opioid system. The significance of studying the rhesus macaque (Macaca mulatta) variant stems from its high homology to human OPRM1, making it valuable for translational research. OPRM1 is crucial in regulating reward pathways associated with both drug use and natural experiences, including social interaction, primarily through actions in the nucleus accumbens . The receptor is encoded by the OPRM1 gene and is also known by synonyms including MOR1, M-OR-1, and MOR-1 .

Research on Macaca mulatta OPRM1 provides insights into pain modulation mechanisms, addiction processes, and social behavior that can be more directly translated to human applications compared to rodent models. The receptor regulates mesolimbic dopamine pathways, which are integral to brain reward systems, influencing motivation and feelings of pleasure .

What expression systems are most effective for producing recombinant Macaca mulatta OPRM1?

  • E. coli system: Provides high protein yield but may lack post-translational modifications. This system is suitable for studies requiring large quantities of protein for structural analysis or antibody production. The recombinant protein is typically expressed with an N-terminal His-tag to facilitate purification .

  • Mammalian cell lines: More appropriate for functional studies as they provide native-like post-translational modifications and membrane insertion. HEK293 or CHO cells are commonly used for GPCR expression when signaling capabilities need to be preserved.

  • Insect cell systems: Offer a compromise between bacterial and mammalian systems, with reasonable yields and some post-translational modifications.

The choice of expression system should align with experimental objectives. For instance, if studying receptor trafficking or signaling, mammalian expression systems would be more suitable despite lower yields. For structural studies or binding assays, the E. coli system might be preferable due to higher protein yields .

How should researchers optimize storage and handling of recombinant OPRM1 protein for experimental reliability?

Proper storage and handling of recombinant OPRM1 protein are critical for maintaining its structural integrity and functional activity. Based on established protocols, researchers should implement the following methodological procedures:

  • Initial processing: Upon receipt, briefly centrifuge the vial containing lyophilized OPRM1 protein to ensure all content settles at the bottom before opening .

  • Reconstitution protocol: Reconstitute the lyophilized protein in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL. For long-term storage, add glycerol to a final concentration of 5-50% (with 50% being optimal for many applications) .

  • Aliquoting strategy: Divide the reconstituted protein into multiple small-volume aliquots to avoid repeated freeze-thaw cycles, which significantly degrade protein quality .

  • Storage conditions: Store working aliquots at 4°C for short-term use (up to one week). For longer-term storage, maintain aliquots at -20°C or preferably -80°C .

  • Buffer considerations: The protein is typically supplied in a Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain stability during freeze-thaw cycles .

  • Thawing procedure: When using frozen aliquots, thaw rapidly at room temperature or 37°C and keep on ice after thawing. Avoid repeated freeze-thaw cycles as this can lead to protein denaturation and loss of activity .

By adhering to these handling protocols, researchers can minimize variability in experimental outcomes and ensure consistent protein activity across studies.

What are the key considerations for designing OPRM1 knockout or knockdown models for comparative studies?

When designing OPRM1 knockout or knockdown models for comparative studies, researchers should consider several methodological and interpretative factors:

  • Selection of knockout strategy:

    • Complete knockouts (Oprm1−/−) demonstrate more severe phenotypes but may trigger compensatory mechanisms during development

    • Heterozygous models (Oprm1+/−) better represent partial dysregulation of μ-opioid signaling that might be more relevant to certain neuropsychiatric conditions

    • Conditional or inducible knockout systems allow for temporal control, minimizing developmental compensation

  • Control considerations: Include both wild-type (Oprm1+/+) and heterozygous (Oprm1+/−) controls to assess gene dosage effects, as research has shown that even partial reduction in μ-opioid signaling can significantly alter brain function and behavior .

  • Reporter gene incorporation: Consider including reporter genes (e.g., Drd1-tdTomato, Drd2-eGFP) to facilitate visualization of specific neuronal populations, particularly when studying nucleus accumbens microcircuitry .

  • Behavioral assessment design: When examining social behavior, evaluate both the knockout subject and their wild-type interaction partners, as studies have shown that interaction with Oprm1 mutants alters the behavior of wild-type animals in a reciprocal fashion .

  • Cross-validation approaches: Employ multiple behavioral paradigms (e.g., direct social interaction, social preference tests, conditioned place preference) to thoroughly characterize the phenotype, as different aspects of social behavior may be differentially affected by OPRM1 mutations .

  • Tissue-specific considerations: Brain region-specific knockdown may be more appropriate when studying specific neural circuits, as global knockouts can have confounding peripheral effects.

Research has demonstrated that even heterozygous knockout models (Oprm1+/−) display significant alterations in nucleus accumbens microcircuitry and social behavior, suggesting that partial reductions in μ-opioid signaling can have substantial effects on brain function and behavior .

How does variation in OPRM1 impact conditioned pain modulation (CPM) and what are the implications for pain research?

Genetic variation in OPRM1 significantly influences conditioned pain modulation (CPM), with important methodological implications for pain research:

  • OPRM1 genotype effects: The single nucleotide polymorphism rs1799971 in the OPRM1 gene affects CPM efficacy. Individuals with the G-genotype (A/G or G/G) demonstrate poorer ability to activate descending pain modulation compared to those with the AA-genotype . This finding is counterintuitive to the traditional understanding that the G-genotype confers increased receptor affinity for β-endorphins.

  • Mechanistic insights: Individuals with the OPRM1 G-allele have reduced μ-opioid receptor availability in brain regions implicated in pain regulation . This suggests that despite higher initial binding affinity for endogenous opioids, there are fewer receptors available to initiate pain inhibition from antinociceptive neurons, resulting in reduced CPM efficacy.

  • Interaction with chronic pain conditions: The effect of OPRM1 genetic variants is particularly pronounced in fibromyalgia patients, who already demonstrate reduced CPM compared to healthy controls. Fibromyalgia patients carrying the OPRM1 G-allele show the lowest CPM scores, suggesting a compounding effect of genotype and chronic pain condition .

  • Gene-gene interactions: Research has identified a significant interaction between OPRM1 and serotonergic system genes. Specifically, the OPRM1 G-genotype combined with the 5-HT1a CC-genotype confers significantly reduced ability to activate descending pain modulation compared to other genetic combinations .

  • Experimental design considerations: When designing pain research protocols, researchers should consider genotyping participants for OPRM1 variants to account for this source of variability in CPM responses. The conditioning stimulus intensity should be standardized (e.g., ischemic pain inducing approximately VAS 77/100) to ensure consistent engagement of endogenous opioid systems .

These findings highlight that OPRM1 genetic variation independently influences pain behavior without exogenous opioids being involved, and should be considered when designing and interpreting pain modulation studies.

What roles does OPRM1 play in stress-depression interactions, and how should researchers design studies to investigate these relationships?

Research on OPRM1 and stress-depression interactions reveals complex gene-environment interactions that require careful methodological consideration:

  • Stress sensitivity modulation: OPRM1 genetic variants interact with stressful life events to influence depression risk. Studies demonstrate that individuals with specific OPRM1 SNPs (rs524731, rs9478503, rs3778157, rs10485057, and rs511420) show differential susceptibility to stress—they have fewer depressive symptoms under low-stress conditions but more symptoms under high-stress conditions compared to major allele homozygotes .

  • Neurobiological mechanisms: OPRM1 polymorphisms are associated with altered activity in mesocorticolimbic brain areas, which are integral to the brain's reward system. Variation in OPRM1 is linked to changes in hypothalamic-pituitary-adrenal (HPA) axis functioning in both humans and rhesus monkeys, affecting cortisol response to stress .

  • Study design recommendations:

    • Sample selection: Include participants with varying stress exposures to detect gene-environment interactions

    • Stress assessment: Employ validated measures of stressful life events frequency and impact

    • Multilevel analysis: Use multilevel regression models to test interactive effects of multiple OPRM1 SNPs and stressful life events on depression

    • SNP coding approaches: Test both additive and dominant forms of genetic coding to identify the most appropriate genetic model

    • Multiple testing correction: Implement appropriate statistical corrections for testing multiple SNPs while accounting for the correlated nature of genetic variants

  • Population considerations: Research should include diverse ethnic groups, as genetic associations may vary across populations. The existing literature shows significant associations in African American adolescents, but these findings may not translate directly to other ethnic groups .

  • Developmental timing: Studies suggest that adolescence may be a particularly sensitive period for OPRM1-stress interactions. Longitudinal designs that capture developmental trajectories can provide valuable insights into how these interactions evolve over time .

For comprehensive investigation of OPRM1-stress interactions, researchers should combine genetic analysis with neuroimaging and endocrine measures to elucidate the underlying biological mechanisms that mediate the relationship between OPRM1 variation, stress exposure, and depression.

How does OPRM1 influence social behavior, and what methodological approaches are most effective for studying these effects?

OPRM1 plays a crucial role in regulating social behavior through its actions in the nucleus accumbens. Research examining social behavior in OPRM1 mutant models reveals several key methodological considerations:

  • Gene dosage effects: Both homozygous (Oprm1−/−) and heterozygous (Oprm1+/−) mutations in OPRM1 result in altered social behavior, suggesting that even partial reductions in μ-opioid signaling can significantly impact social functioning . Experimental designs should include both genotypes to fully characterize dose-dependent effects.

  • Reciprocal social interaction analysis: When studying social behavior, researchers should analyze not only the behavior of the OPRM1 mutant subject but also the behavior of their wild-type interaction partners. Studies show that interaction with Oprm1 mutants alters the behavior of wild-type mice in a reciprocal fashion, providing a more complete understanding of social dynamics .

  • Multiple behavioral paradigm approach: Research indicates dissociations between different facets of social behavior in OPRM1 mutants. Employing multiple assessment methods reveals these nuances:

    • Direct social interaction tests capture reciprocal behavior

    • Real-time social preference tests demonstrate that wild-type mice avoid social interaction with Oprm1−/− mice

    • Conditioned place preference paradigms show that while Oprm1−/− mice prefer interaction with other Oprm1−/− mutants, these interactions do not produce conditioned place preference

  • Neural circuit analysis: Employing electrophysiological recordings from nucleus accumbens medium spiny neurons provides mechanistic insights into how OPRM1 mutations affect the microcircuitry underlying social behavior. This approach reveals that OPRM1 mutations alter excitatory and inhibitory inputs to both D1 and D2 receptor-expressing neurons .

  • Experimental preparation considerations: When conducting ex vivo electrophysiological studies, careful attention to brain slice preparation is essential. Recommended methods include:

    • Rapid anesthesia with isoflurane

    • Quick brain removal and placement in ice-cold cutting solution (containing specific concentrations of sucrose, NaHCO3, glucose, KCl, etc.)

    • Precise sectioning techniques to preserve nucleus accumbens circuitry

These methodological approaches collectively provide a comprehensive framework for investigating how OPRM1 influences social behavior through its effects on neural circuitry, with implications for understanding social deficits in neuropsychiatric conditions.

What are the key differences between human and Macaca mulatta OPRM1, and how do these impact translational research?

Understanding the differences between human and Macaca mulatta OPRM1 is crucial for translational research integrity. Key considerations include:

  • Sequence homology: While human and Macaca mulatta OPRM1 share high sequence homology (approximately 95-98%), subtle differences in amino acid composition can affect ligand binding properties and downstream signaling. Researchers should acknowledge these differences when extrapolating findings from rhesus macaque models to human applications.

  • Pharmacological response variations: Studies suggest that rhesus macaque OPRM1 may exhibit somewhat different binding affinities for certain opioid ligands compared to human OPRM1. These differences must be accounted for when designing pharmacological studies and interpreting dose-response relationships.

  • Polymorphic variations: The A118G polymorphism (rs1799971) in human OPRM1 corresponds to a similar but not identical polymorphism in Macaca mulatta. Research has shown that these genetic variants affect μ-opioid receptor availability and function, including responses to stress and pain processing . When studying OPRM1 variants, researchers should carefully characterize the corresponding functional effects in each species.

  • Expression pattern differences: While the general distribution pattern of OPRM1 is similar between species, there may be subtle differences in expression levels across brain regions. Region-specific expression analysis using techniques like in situ hybridization or quantitative PCR can help characterize these differences.

  • Methodological solutions:

    • When designing studies, include species-matched controls and standards

    • Consider using humanized OPRM1 mouse models for certain applications requiring high translational value

    • When possible, validate key findings in both rhesus macaque and human tissues or cells

    • Employ computational modeling to predict functional consequences of sequence differences

By accounting for these species differences, researchers can design more effective translational studies and appropriately contextualize findings derived from Macaca mulatta OPRM1 research.

What are common technical challenges in working with recombinant OPRM1, and how can researchers overcome them?

Working with recombinant OPRM1 presents several technical challenges that researchers should anticipate and address:

  • Solubility and aggregation issues:

    • Challenge: As a membrane protein, OPRM1 has hydrophobic domains that can cause aggregation during expression and purification.

    • Solution: Include appropriate detergents or lipid nanodiscs during purification. Reconstitution in buffer containing 6% trehalose at pH 8.0 can enhance stability . Optimize protein concentration to avoid aggregation-prone conditions (recommended working concentration: 0.1-1.0 mg/mL) .

  • Preservation of native conformation:

    • Challenge: Maintaining the native tertiary structure of OPRM1 is essential for functional studies but difficult during recombinant expression.

    • Solution: Consider using mammalian expression systems for functional studies despite lower yields. When using E. coli systems, optimize refolding protocols and validate protein conformation using circular dichroism or ligand binding assays.

  • Post-translational modification differences:

    • Challenge: E. coli-expressed OPRM1 lacks mammalian post-translational modifications that may be crucial for certain functions.

    • Solution: For studies requiring native modifications, use mammalian or insect cell expression systems. Alternatively, employ site-directed mutagenesis to mimic the effect of specific modifications.

  • Protein yield optimization:

    • Challenge: Obtaining sufficient quantities of functional recombinant OPRM1 can be difficult.

    • Solution: Optimize induction conditions (temperature, inducer concentration, duration) and consider using specialized E. coli strains designed for membrane protein expression. Adding fusion partners like MBP (maltose-binding protein) can improve solubility and yield.

  • Storage stability:

    • Challenge: OPRM1 protein activity can degrade with repeated freeze-thaw cycles.

    • Solution: Store the protein in small aliquots to avoid repeated freeze-thaw cycles. Add 5-50% glycerol to the storage buffer, with 50% being optimal for long-term storage . For working stocks, store at 4°C for up to one week rather than repeatedly freezing and thawing .

  • Functional validation approaches:

    • Challenge: Confirming that recombinant OPRM1 retains native binding properties can be difficult.

    • Solution: Perform radioligand binding assays with known μ-opioid receptor ligands. Compare binding affinities with those reported for native receptors to ensure functional integrity.

By anticipating these challenges and implementing appropriate methodological solutions, researchers can improve the quality and reliability of their recombinant OPRM1 experiments.

How should researchers interpret contradictory findings regarding OPRM1 genetic variants and their functional effects?

The literature contains several apparent contradictions regarding OPRM1 genetic variants, particularly the A118G polymorphism (rs1799971). Researchers should consider the following interpretative framework when navigating these contradictions:

  • Opposing theoretical frameworks:

    • Some studies suggest that the OPRM1 G-genotype confers increased receptor affinity for β-endorphins, theoretically enhancing endogenous opioid efficacy

    • Contradictorily, individuals with the G-genotype require higher doses of exogenous opioids for pain relief, suggesting reduced opioid efficacy

    • Resolution approach: Consider that these findings represent different aspects of a complex system—initial binding affinity versus system-wide response and receptor availability

  • Receptor availability paradox:

    • The G-allele may increase binding affinity but simultaneously reduce μ-opioid receptor availability in key brain regions

    • Proposed mechanism: Enhanced initial binding may trigger increased receptor internalization or downregulation, resulting in fewer available receptors during sustained endogenous opioid release

    • This provides a mechanistic explanation for why G-allele carriers show reduced CPM efficacy despite theoretically higher binding affinity

  • Contextual factors to consider:

    • Stress exposure: OPRM1 variants show different effects under varying stress conditions—some confer resilience under low stress but vulnerability under high stress

    • Developmental timing: Effects may differ based on when the system is challenged (developmental versus acute adult effects)

    • Ethnic differences: Genetic background may modify the functional impact of OPRM1 variants across different populations

    • Gene-gene interactions: Interactions with other systems (e.g., serotonergic system) may determine the net effect of OPRM1 variants

  • Methodological resolution strategies:

    • Employ multimodal approaches combining genetic, neuroimaging, and behavioral measures

    • Design studies that explicitly test competing hypotheses about mechanism

    • Include measures at multiple levels (molecular, cellular, circuit, behavioral)

    • Consider pharmacological challenges that can dissociate different aspects of opioid function

  • Interpretative framework: Rather than viewing contradictory findings as errors, researchers should consider that they might reflect the complexity of opioid system regulation, including phenomena such as:

    • Compensatory mechanisms following genetic variation

    • Different effects on tonic versus phasic opioid signaling

    • Region-specific and circuit-specific consequences of genetic variation

By adopting this nuanced interpretative approach, researchers can reconcile apparently contradictory findings and develop more comprehensive models of how OPRM1 genetic variants influence complex phenotypes.

How can researchers effectively integrate OPRM1 findings across different experimental models and species?

Integrating OPRM1 findings across experimental models and species requires systematic approaches to address scale and translational gaps:

  • Cross-species comparative analysis framework:

    • Establish homologous phenotypes across species (from cellular to behavioral levels)

    • Map genetic variants between species (e.g., human A118G/rs1799971 with corresponding macaque variants)

    • Compare receptor distribution patterns using consistent neuroanatomical references

    • Develop standardized assays that can be applied across species with minimal modification

  • Multi-level integration approach:

    • Molecular level: Compare binding affinities, signaling cascades, and receptor trafficking

    • Cellular level: Examine electrophysiological properties and cell-type specific effects

    • Circuit level: Map analogous neural circuits across species (e.g., nucleus accumbens microcircuitry)

    • Behavioral level: Develop cross-species behavioral paradigms with validated translational value

  • Data harmonization strategies:

    • Use consistent operational definitions and outcome measures where possible

    • Develop conversion algorithms for species-specific measures

    • Employ statistical approaches that can accommodate different data scales and distributions

    • Create shared databases and repositories for OPRM1-related findings

  • Triangulation methodology:

    • Test hypotheses across multiple models and species

    • Prioritize findings that show convergence across different experimental approaches

    • When divergent results emerge, systematically identify moderating factors

  • Translational bridges:

    • Use humanized animal models for key experiments

    • Employ computational modeling to predict cross-species differences

    • Design parallel human and animal studies with matched methodologies

    • Consider intermediate models (e.g., induced pluripotent stem cells, organoids) that can bridge between animal models and human subjects

  • Contextual factors to document:

    • Developmental stage and age equivalence across species

    • Environmental conditions (stress levels, social housing, etc.)

    • Previous drug exposure history

    • Sex and hormonal status

What novel applications of recombinant OPRM1 are emerging in neuropsychiatric research?

Emerging applications of recombinant OPRM1 in neuropsychiatric research are opening new avenues for understanding and treating various conditions:

  • Precision medicine approaches:

    • Development of OPRM1 genotype-guided treatment protocols for pain management, considering that OPRM1 variants affect both endogenous pain modulation and response to exogenous opioids

    • Personalized approaches for depression treatment based on OPRM1-stress interaction profiles, as certain variants show differential susceptibility to stress effects on depression

  • Novel therapeutic target identification:

    • Exploration of specific OPRM1 signaling pathways that could be targeted without the adverse effects of conventional μ-opioid agonists

    • Investigation of biased ligands that selectively activate beneficial signaling cascades downstream of OPRM1 activation

    • Development of allosteric modulators that can fine-tune OPRM1 function based on endogenous opioid tone

  • Social deficit intervention development:

    • Based on findings that OPRM1 regulates social behavior and reward, development of targeted interventions for social deficits in conditions like autism spectrum disorders and schizophrenia

    • Creation of screening platforms using recombinant OPRM1 to identify compounds that could enhance social reward processing

  • Advanced brain imaging applications:

    • Development of novel PET ligands with enhanced specificity for different OPRM1 variants to enable non-invasive assessment of receptor availability in neuropsychiatric conditions

    • Combining genetic information with imaging to create predictive models of treatment response

  • Gene-environment interaction studies:

    • Use of recombinant OPRM1 variants in cell culture systems to model molecular responses to environmental stressors

    • Development of high-throughput screening systems to identify environmental factors that interact with specific OPRM1 variants

  • Innovative research methods:

    • Application of CRISPR-Cas9 technology to create precise OPRM1 variants in cell and animal models

    • Development of inducible and region-specific OPRM1 manipulation approaches to dissect temporal and spatial aspects of receptor function

    • Implementation of chemogenetic approaches using modified OPRM1 receptors to achieve precise control over opioid signaling in specific neural circuits

These emerging applications highlight the expanding role of OPRM1 research in advancing our understanding of neuropsychiatric conditions and developing more targeted therapeutic approaches.

What are the most promising directions for understanding gene-environment interactions involving OPRM1?

Research on gene-environment interactions involving OPRM1 reveals several promising directions for future investigation:

  • Stress resilience and vulnerability:

    • Further exploration of the finding that certain OPRM1 SNPs (rs524731, rs9478503, rs3778157, rs10485057, rs511420) confer differential susceptibility to stress—with carriers showing fewer symptoms under low stress but increased vulnerability under high stress

    • Investigation of the neurobiological mechanisms underlying this crossover interaction pattern

    • Development of preventive interventions targeting high-risk individuals during periods of anticipated stress

  • Developmental timing of environmental influences:

    • Examination of sensitive periods during which OPRM1-environment interactions have particularly strong effects

    • Longitudinal studies tracking how these interactions shape developmental trajectories

    • Investigation of epigenetic mechanisms that might mediate long-term effects of early-life experiences on OPRM1 expression and function

  • Complex gene-gene-environment interactions:

    • Expanded research on interactions between OPRM1 and serotonergic system genes (e.g., 5-HT1a) in modulating responses to environmental challenges

    • Development of polygenic profiles that can better predict individual differences in environmental sensitivity

    • Investigation of how these genetic interactions affect neural circuit development and function

  • Methodological advances:

    • Implementation of ecological momentary assessment to capture real-time environmental influences and behavioral responses

    • Use of wearable technology to monitor physiological responses to environmental stressors in genotyped individuals

    • Development of computational models that can integrate multilevel data (genetic, neural, behavioral) to predict individual responses to environmental challenges

  • Translational applications:

    • Creation of precision medicine approaches that consider both OPRM1 genotype and environmental context

    • Development of environmental modification strategies tailored to genetic risk profiles

    • Exploration of pharmacological approaches that might mitigate genetic vulnerability during periods of environmental stress

  • Broader environmental considerations:

    • Investigation of how cultural and socioeconomic factors interact with OPRM1 genotype

    • Examination of diet, sleep, and physical activity as potential moderators of genetic effects

    • Study of how social support might buffer genetic vulnerability to stress

These directions highlight the importance of considering OPRM1 not in isolation but as part of a complex dynamic system influenced by environmental factors across development. Future research should aim to translate these insights into personalized interventions that consider both genetic and environmental factors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.